KEGG   Bifidobacterium adolescentis BBMN23: BBMN23_0015Help
Entry
BBMN23_0015       CDS       T03774                                 

Definition
(GenBank) hypothetical protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bado  Bifidobacterium adolescentis BBMN23
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bado00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBMN23_0015
  Energy metabolism
   00680 Methane metabolism
    BBMN23_0015
Enzymes [BR:bado01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BBMN23_0015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(21415..24171)
Genome map
AA seq 918 aa AA seqDB search
MTTENEQITPADAAIVSSGTGTKGPEERDLPASLKEEMDLCLQILREVLGEFDENLLAKF
DEVREHALKASDERFSGILTDTNPDQDDLQKVVDIIDKTDVHEAQLLARAFTTYFHLANL
CEENYRVSVLHSRENAVDDTQAVDPVNEMTCAYHQLINEMGPARAKELLDQLEFHPVFTA
HPTEARRKAVEGKIRRISQLLEAHKLLGGSDKKENSRRLFNEIDALFRTSPIALKKPTPV
EEADTILDIFDNTLFYTIPQVYRRFDDWVLGDKAGLVPPVCPAFFHPGSWIGSDRDGNPN
VTAKVSRQVARKFSDHVLGALEIETRRVGKNLTMEAETTPPSAELKSLWNHQKEMSERLT
DKAALISTKELHRAVMLVMADRLKATIDRDADLMYHSCEDYIADLKTVQRSLAEANAKRS
AYGPLQDLIWQAETFGFHMVEMEFRQHSVVHSRALEDIREHGLHGERGELQPMTHEVLDT
FRALGSIQKRNGIKAARRYIISFTKSAQNIKDVYELNRLAFSHPEDVPTIDVIPLFEQLE
DLQNSVDVLEEMIKIPEVQARLKATGGKMEVMLGYSDSSKDAGPTSATLALHSAQERIAK
WAESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPVL
AIRHVESVAAATLLQSAPSVEKRNTDMTKKYADMASKLDEAAHNRFLDLLNTDGFAPWFS
TVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEQFG
DLNTLRQAYEEWPLFSTFIDNIEMSLAKTDERIAKMYLALGDREDLNKKVLDEMELTRKW
VLEIVGDKWPLQHRHVLGQAIRIRSPYVDALSATQVLALGSLRKRVDKEELTHGQKENYT
YLILCTVSGVAAGLQNTG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgaaaacgaacagatcacgcctgcggacgcggctatcgtctcgtccggcacc
ggcaccaagggccctgaggagcgtgatcttcccgcatccctcaaagaggaaatggatctg
tgtctgcagattcttcgcgaggtgctcggtgagttcgatgaaaacctgctggccaagttc
gatgaagtgcgcgaacatgcgctgaaggccagtgacgaacgtttctccggcattctgacc
gacacgaatcccgatcaggacgacctgcagaaggttgtcgacatcatcgacaagacggac
gtgcatgaggcccagctgttggctcgtgccttcaccacttacttccatctggccaatctg
tgcgaggagaactaccgtgtctccgtgctgcacagccgtgagaacgccgttgacgacacc
caggccgtcgatccggtgaacgaaatgacctgcgcctaccaccagctcatcaacgagatg
ggtccggccagagccaaggagctgctcgaccagctcgagttccatccggtgttcaccgcg
catccgaccgaagcccgccgtaaggccgtggaaggcaagatccgccgcatctcccagctg
ctcgaagcgcataagctgctcggcggctcggacaagaaggaaaactcccgtcgactcttc
aacgagatcgacgcgctgttccgcacctccccgatcgcgctgaagaagccgactccggtt
gaggaagccgacaccattcttgatatcttcgacaacacgctgttctacaccattccgcag
gtctaccgtcgtttcgacgactgggtcctcggagacaaggccggcctcgtgccgccggtg
tgcccggcgttcttccatccgggaagctggatcggttccgaccgtgacggcaacccgaac
gtcaccgccaaggtgagccgtcaggtggcccgcaagttcagcgaccacgtgctgggcgcg
ctggagatcgagacccgccgcgtcggcaagaacctgacgatggaggccgagaccaccccg
ccgagcgccgagctcaagtccctgtggaaccaccagaaggaaatgagcgagcgtctgacc
gacaaggccgcgctgatctccaccaaggagctgcaccgcgccgtcatgctggtcatggca
gaccgtctgaaggccaccatcgaccgcgacgccgacctcatgtaccactcctgcgaggac
tacatcgccgatctgaagaccgtgcagcgctccctcgccgaagccaacgccaaacgttcc
gcctacggcccgctgcaggacctcatctggcaggccgagaccttcggcttccacatggtc
gagatggagttccgtcagcattccgtcgtgcattcccgcgctctggaggacatccgcgag
catggcctgcacggtgagcgtggcgagctgcagccgatgacccacgaggtgctcgacacc
ttccgcgcgctcggttccatccagaagcgcaatggcatcaaggccgcccgccgttacatc
atctccttcaccaagagcgcccagaacatcaaggacgtgtacgaactgaaccgtctggcg
ttctcccaccccgaggatgttccaaccatcgacgtgattccgctgttcgagcagcttgag
gatctgcagaactcggtggacgtgctcgaggaaatgatcaagatcccggaggtccaggct
cgtctgaaggccaccggcggcaagatggaagtcatgctcggctactccgactcctcgaag
gacgccggcccgacctccgccacccttgccctgcactccgcgcaggagcgcatcgccaag
tgggccgaatcgcacgacatcgacctgaccctgttccatggccgcggcggcgccgtcggt
cgtggcggcggcccggccaaccgcgccgtgctcgcacagccggtcggctccgtgaagtgc
cgtttcaagctcaccgagcagggcgaggtcatcttcgcccgctacggcaacccggtgctg
gcaatccgccacgtggagtccgtcgcagccgcaacgctgctgcagtccgctccgagcgtt
gagaagcgcaacacggatatgaccaagaagtacgccgacatggccagcaagctcgacgag
gccgcgcacaaccgcttcctcgacctgctgaacaccgacggcttcgcaccgtggttctcc
accgtcacgccgctgaccgaaatcggcctgctgccgatcggctcccgtccggcgaagcgt
ggtctgggcgccaagtccctcgacgacctgcgcaccattccgtggatcttctcctgggcg
caggcccgcatcaacctggccgcatggtacggcctcggcaccgcgtgcgagcagttcggc
gacctgaacaccttgcgtcaggcgtacgaggagtggccgctgttctccacgttcatcgac
aacatcgaaatgtcgctggccaagaccgacgagcgcatcgccaagatgtacctcgccctc
ggcgaccgtgaggacctcaacaagaaggtcctcgacgagatggagctcacccgcaagtgg
gtgctcgagattgtaggcgacaagtggcctctgcagcaccgccacgtgctcggccaggcc
atccgcatccgctcgccgtacgtggacgcgctgtccgccacccaggtgctcgccctcggc
tcgctacgcaagcgcgtggacaaggaagagctcacgcacggacagaaggagaactacacc
tatctgatcctgtgcaccgtttcgggcgtcgccgcaggcctgcagaacacgggctga

DBGET integrated database retrieval system