KEGG   Bacillus atrophaeus 1942: BATR1942_16490Help
Entry
BATR1942_16490    CDS       T01339                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00240  Pyrimidine metabolism
bae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BATR1942_16490
Enzymes [BR:bae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BATR1942_16490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK zf-C4_ClpX AAA_19
Motif
Other DBs
NCBI-ProteinID: ADP34217
UniProt: A0A0H3E4N7
LinkDB All DBs
Position
complement(3224254..3224850)
Genome map
AA seq 198 aa AA seqDB search
MYIMKQSGWLELICGSMFSGKSEELIRRVKRATYAKQEVRVFKPAIDNRYSEEAVVSHNG
TSMTSHVIAAPAEIWNHISETTDVIAVDEVQFFDRMIIEVLSSLADKGYRVIAAGLDMDF
RGEPFGVVPDLMAMAETVTKLQAVCSVCGSPASRTQRLINGKPASYDDPIILVGASESYE
ARCRHHHEVPEKAGNAGN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacataatgaagcaaagcgggtggctggagctgatttgcggcagtatgttctctggg
aaatcggaagagctgatccgaagagtgaagagagcgacttatgccaaacaggaagtcaga
gtatttaagcccgctatagataaccggtacagtgaggaagccgttgtctctcacaacgga
acgtcgatgacaagccatgttattgccgctcctgctgaaatatggaaccacatcagtgaa
acgacagatgtgattgcggttgatgaggtgcaattttttgaccggatgatcattgaagtc
ttgtcgtcgctcgccgataaaggatatcgtgtcattgcggcgggtcttgatatggatttc
aggggagaaccgttcggcgtggtgcctgatttgatggcaatggctgaaacagttacaaag
cttcaagccgtctgttctgtctgcggatcacccgcaagccgtactcagcgccttattaat
ggtaagcctgcttcttatgatgatcctatcattttggtcggggcgtcagaatcatatgaa
gcaagatgcagacaccatcacgaggtcccggagaaagcaggaaatgcaggaaactag

DBGET integrated database retrieval system