KEGG   Bacillus coagulans 36D1: Bcoa_0655Help
Entry
Bcoa_0655         CDS       T01628                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bag  Bacillus coagulans 36D1
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcoa_0655
  Energy metabolism
   00680 Methane metabolism
    Bcoa_0655
Enzymes [BR:bag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Bcoa_0655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
695693..698452
Genome map
AA seq 919 aa AA seqDB search
MHQIDEKKAPRMALQADMDFLAGLLDKVILFEGGEALLKTIQNIRSLAQKARETGDEAFY
LQLKKEITDLNPPERQEVIRAFSTYLQLFNITEQNFRIKRRREYQSEDTDQVQPRSLEDG
IETLRKEKVPAEMVAELLNSLSLELIITAHPTEATRRTILQIHKRIADLLKALEYANTRY
EKKVIEETILNEITILWQSSEIREKKPSVLDEVKNGLYYFDNVLFDVLPRIHEDLEDYLH
ESYGQRFKVPSYLHFGSWIGGDRDGNPNVTADITWKTLEMQRELVLEKYKKSLTTLRELL
SHSSKKISASHALLASVESEENTMPAAKLWPTKDEIYRRKLTIMIHKLECVGKNNGGYQS
AKELLADLYMIRDSVNQHHPAGHPIKLLRKVIRQVELFGFHLASLDIRNHSGEHESALAE
VLYNVNIAKDYKNLSEDEKVAVLLKALNDPRPMISIYDTFTPETQEVINTFRMIKRAHQT
FGERSIQVYLISMAHSVSDVLEVLVLAKEAGLYRVYPSGDILSEIHIAPLLETIADLRNG
AKMLETLFQMPIYRNHLKVRGNLQEVMLGYSDGSKDGGTMTANWQLYKAQKEIHEMGAKY
GIKLKFFHGRGGSLGRGGGPLYSSLLSQPPVTLGDGVKITEQGEVLSSRYLLRDIAYRSL
EQATSTMMCAITEQKQNEKNGKTPNEEAVRAMDKISEYALEKYQELVFRDPDFLSYFKQA
TPLNEIGELNIGSRPMSRKGSARFEDLRAIPWVFSWTQSRQLLPAWYAAGTGLSKYVEET
GNFKLLQEMYASWPFFHATINNLQMALIKAELSTAEEYTRLVKDPEVAGRIFGLIKAEYE
LTKEMVLKIADQKELLDYTPNIKESVRLRNPYVDPLNLFQVYLISQLRERENKDEKARHL
LMEVLLTINGIAAGLRNTG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
ttgcatcaaattgatgaaaagaaagcaccccggatggcactgcaggcagacatggatttt
ctcgccgggctgctggataaagtgatcctatttgaaggcggcgaagcattgctcaaaacg
atccaaaatattcgctccctggcacaaaaagcgagggaaaccggcgatgaggctttctac
cttcaattaaaaaaagaaattacagatctgaatccgccagaacggcaggaagtcatccgc
gctttctctacctatctgcaattatttaatattaccgagcaaaatttcagaattaagcgc
cggcgggagtaccaatcggaagatacagaccaggttcaaccgcgttcacttgaagatggc
attgaaacgctgcggaaagaaaaagtgccagctgaaatggttgcagaactgttgaacagt
ttatcgcttgagctgattataacggcacacccgacagaagcaacgaggcggaccattctg
caaatccacaaacgaattgcagatcttttaaaagcgctcgaatatgcaaacacccgttat
gagaaaaaagttattgaagaaacgattttgaatgagattaccattttatggcaaagttcc
gaaatccgcgaaaagaaaccgtccgttctcgacgaagtgaaaaacgggctttactatttc
gacaatgtcctgttcgacgtgctgccgcgcatacacgaagatttggaagactatctgcac
gaatcgtacggacagcgttttaaagtcccttcctatcttcattttggctcgtggatcggc
ggcgaccgggacggaaacccgaacgtgaccgcggacatcacctggaaaacgctcgaaatg
caacgtgaactcgtattggaaaaatataaaaagtcgcttacaacactccgggagctcctc
agccattcttccaaaaaaataagcgccagccatgccctgcttgcgtctgtggaaagcgaa
gaaaatacaatgccggctgcaaaattatggccgacaaaagatgaaatttaccgcagaaag
ctgacgattatgatccataaactggaatgtgtgggaaaaaacaatggcggctaccaatcc
gcaaaggagctccttgccgatctgtatatgatccgggacagcgtgaaccagcaccatccg
gccgggcatccgattaaattgctccgcaaagtcatccgccaggtcgaattgttcggtttc
cacctggcatcgctcgatatccgcaaccatagcggcgagcatgaatcggcccttgccgag
gtgctttataacgtcaatattgcgaaggactataaaaatctgtccgaagatgaaaaagtc
gcggtgctcctgaaggctttaaacgacccgcggccgatgatttcaatctatgatactttt
acgccggaaacgcaggaagtcatcaatacattccggatgatcaaacgcgcccaccaaaca
tttggcgaacggtccatccaggtatatttgatcagcatggcacactcggtcagcgacgtg
ctggaagtgctcgtgctcgcgaaagaagccggcctgtaccgcgtctacccgagcggggat
attttaagcgagatccatatcgccccgcttctggaaacgatcgcggacttgcggaacggc
gcgaaaatgctcgaaacccttttccaaatgcccatttaccggaaccatttaaaggtgcga
ggcaatctgcaggaagtcatgctcggctattccgacggcagcaaagacggcggcacgatg
acagcgaactggcagctgtacaaagcacagaaagaaattcacgaaatgggcgccaaatac
ggcatcaagctgaaatttttccacgggcgcggcggttcgctcgggcgtggcggcggcccg
ctttattcaagccttttgtcccagccgccagttacacttggcgacggcgtgaaaatcacc
gagcagggtgaggtgctgtcatcgcgctatttgctgcgcgacattgcttaccgaagcctt
gagcaggcgacatctacaatgatgtgtgccatcacggaacaaaaacagaacgagaaaaat
ggcaaaacgccaaacgaagaagctgtcagggcaatggataaaatttccgaatatgcgctt
gaaaaatatcaggaactcgtcttccgcgaccctgacttcctgtcttatttcaaacaggca
acgcctttaaatgagatcggtgaactcaacatcggctcccgcccgatgagccggaaaggg
agtgcccgtttcgaagacttgcgcgccattccgtgggtattttcctggacgcaaagccgc
cagctcctccccgcctggtatgcagccggaacaggtctgagcaaatatgtggaagaaacc
ggcaatttcaagttgctccaggaaatgtatgcatcatggccgttcttccacgcaacgatc
aataacctgcaaatggcattgatcaaggcggagctttccacggctgaagaatatacaagg
ctggtgaaagatcctgaagttgccggccggattttcggcctgatcaaagcggaatacgaa
ctaacgaaggaaatggttttaaagattgcggaccaaaaagaattgctggattacacgcca
aacataaaagaatcggtgcgtctccgcaacccgtacgtcgacccgctgaacctgttccaa
gtctaccttatttcgcaactgcgtgaacgcgaaaacaaggatgaaaaagcccggcacctg
ctgatggaggtcctgcttacgatcaacggcatcgccgcagggctccggaatacaggctga

DBGET integrated database retrieval system