KEGG   Bacillus anthracis A0248: BAA_4198Help
Entry
BAA_4198          CDS       T00892                                 

Definition
(GenBank) protein-glutamine gamma-glutamyltransferase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
bai  Bacillus anthracis A0248
Brite
Enzymes [BR:bai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     BAA_4198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3824590..3825420
Genome map
AA seq 276 aa AA seqDB search
MIVIGRSIVHPYITNEYEPFAAEKQQILSIMAGNQEIYSFRTSDELSFDLNLRVNIITSA
LELFQSGFQFRTFQQSFCNPQYWKRTSLGGFELLPNIPPSIAIQDIFKNGKLYGTECATA
MIIIFYKALLSLYEKETFNRLFANLLLYTWDYDQDLKLITKTGGDLVPGDLVYFKNPQVN
PATIEWQGENTIYLGNFFFYGHGVGVKTKEEIIYALNERRVPYAFISAFLTDTITRIDSR
LMSYHASPSTPQTSIGFIPIRDDAIVATVGNTTTVY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaataggccgttctattgtacatccttatatcacaaatgaatatgagccattt
gcagctgagaaacaacaaattttatctataatggcaggaaatcaagaaatctattccttt
cgaacatccgatgaactcagctttgatctaaatttgcgcgttaatattattacttctgca
ttagaactttttcaaagtggttttcagtttcgcacatttcaacaatctttttgcaaccct
caatattggaaaagaacgtctcttggaggattcgagctccttccaaacatacccccttcc
attgccatacaagatattttcaaaaacggaaaactatatggaactgaatgtgccaccgct
atgatcattattttttacaaagctttactatcattgtatgagaaagaaactttcaaccgt
ctctttgcaaaccttttactttatacgtgggactacgatcaagatttaaagctcataaca
aagacaggtggcgatcttgtcccaggtgatctcgtttactttaaaaatccacaagtgaat
ccagctacaatcgagtggcaaggagaaaatacaatctatctaggaaatttctttttttat
gggcatggcgtaggtgtaaaaacaaaagaagaaattatatacgcattaaatgagcgacga
gtcccttacgcttttatttctgctttcttaaccgatactattacccgtattgatagccgt
ctcatgagctaccacgcttctcctagtacaccacagacatccataggatttattccgatt
agagatgatgcaatcgttgcaacagttggcaacacaactacagtttattaa

DBGET integrated database retrieval system