KEGG   Bacillus anthracis A0248: BAA_4518Help
Entry
BAA_4518          CDS       T00892                                 

Gene name
sodA1
Definition
(GenBank) superoxide dismutase, Mn
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bai  Bacillus anthracis A0248
Brite
Enzymes [BR:bai01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BAA_4518 (sodA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(4093778..4094389)
Genome map
AA seq 203 aa AA seqDB search
MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVA
NLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEF
AKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYYLNYQNRRP
DYIGAFWNVVDWNAAEKRYQEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacacgaattaccaaatttaccttatgcgtatgatgctttagagcctcacttt
gacaaagaaacaatgaacatccatcatacaaaacaccataacacgtacatcacaaactta
aacgctgctttagaaggtcatgcagaattagctgacaaaagcgtagaagaattagttgca
aacttaaacgaagtaccagaagcaatccgtacagcagtacgtaacaatggtggcggacat
gctaaccacacattcttctggacaatcttatctccaaacggcggcggacaaccagtaggt
gaacttgcaactgcaattgaagcgaaattcggtagcttcgatgcgttcaaagaagaattc
gcaaaagctggcgcaactcgcttcggttctggttgggcttggttagtagtaaataatggt
gagttagaagtaacaagcacgccaaaccaagattctcctctaactgaaggtaaaactcca
gttatcggtttagatgtttgggaacatgcttactacttaaattaccaaaaccgtcgtcca
gattacatcggtgcattctggaatgttgtagattggaacgctgctgaaaaacgttaccaa
gaagcaaaataa

DBGET integrated database retrieval system