KEGG   Bacillus cereus biovar anthracis CI: BACI_c42450Help
Entry
BACI_c42450       CDS       T01279                                 

Gene name
sodA1
Definition
(GenBank) Mn containing superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bal  Bacillus cereus biovar anthracis CI
Brite
KEGG Orthology (KO) [BR:bal00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    BACI_c42450 (sodA1)
   04068 FoxO signaling pathway
    BACI_c42450 (sodA1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    BACI_c42450 (sodA1)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    BACI_c42450 (sodA1)
   04212 Longevity regulating pathway - worm
    BACI_c42450 (sodA1)
   04213 Longevity regulating pathway - multiple species
    BACI_c42450 (sodA1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    BACI_c42450 (sodA1)
Enzymes [BR:bal01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BACI_c42450 (sodA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4003912..4004547)
Genome map
AA seq 211 aa AA seqDB search
MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELAD
KSVEELVANLNEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAKFGS
FDAFKEEFAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPVIGLDVWEHAYY
LNYQNRRPDYIGAFWNVVDWNAAEKRYQEAK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacacgaattaccaaatttaccttatgcgtatgatgctttagagcctcacttt
gacaaagaaacaatgaacatccatcatacaaaacaccataacacgtacatcacaaactta
aacgctgctttagaaggtcatgcagaattagctgacaaaagcgtagaagaattagctgac
aaaagcgtagaagaattagttgcaaacttaaacgaagtaccagaagcaatccgtacagca
gtacgtaacaatggtggcggacatgctaaccacacattcttctggacaatcttatctcca
aacggcggcggacaaccagtaggtgaacttgcaactgcaattgaagcgaaattcggtagc
ttcgatgcgttcaaagaagaattcgcaaaagctggcgcaactcgcttcggttctggttgg
gcttggttagtagtaaataatggtgagttagaagtaacaagcacgccaaaccaagattct
cctctaactgaaggtaaaactccagttatcggtttagatgtttgggaacatgcttactac
ttaaattaccaaaaccgtcgtccagattacatcggtgcattctggaatgttgtagattgg
aacgctgctgaaaaacgttaccaagaagcaaaataa

DBGET integrated database retrieval system