KEGG   Bacillus sp. LM 4-2: BsLM_3733Help
Entry
BsLM_3733         CDS       T03908                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
balm  Bacillus sp. LM 4-2
Pathway
balm00240  Pyrimidine metabolism
balm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:balm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BsLM_3733
Enzymes [BR:balm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BsLM_3733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK zf-C4_ClpX AAA_22 AAA_19
Motif
Other DBs
NCBI-ProteinID: AKE25530
UniProt: A0A125UNP1
LinkDB All DBs
Position
complement(3655864..3656451)
Genome map
AA seq 195 aa AA seqDB search
MYIMKQSGWLELICGSMFSGKSEELIRRVKRATYAKQEVRVFKPVIDNRYSEAAVVSHNG
TSMTSYAISSASDIWDHISESTDVIAVDEVQFFDQEIVEVLSSLADKGYRVIAAGLDMDF
RGEPFGVVPNIMAIAESVTKLQAVCSVCGSPASRTQRLIDGKPASYDDPVILVGASESYE
ARCRHHHEVPGKSKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtacataatgaaacaaagcgggtggcttgagctgatttgcggcagcatgttctcgggg
aaatctgaagagctgatcagaagagtgaagagagcaacttatgccaagcaggaagtcagg
gtatttaagcctgtaattgataaccgatacagcgaagctgctgttgtctcccataatgga
acatcgatgacgagctatgccatttcgtctgcttcggacatttgggatcacatcagtgaa
agtacagatgtgattgcggttgatgaagtgcagttttttgatcaggaaattgttgaggtt
ttatcatctcttgccgataaaggctaccgtgtgatagcagcaggccttgatatggatttt
aggggagagccgttcggtgtcgtcccgaatatcatggcgattgcggaaagtgtgacaaag
ctgcaagccgtctgttctgtttgcggatcaccggcgagcagaacacagcgcctcattgac
ggcaaacctgcttcttacgatgatccggtcattttggttggtgcatctgaatcatatgaa
gcaagatgcagacatcatcacgaagtcccaggtaaatctaaaaaatag

DBGET integrated database retrieval system