KEGG   Burkholderia ambifaria AMMD: Bamb_3323Help
Entry
Bamb_3323         CDS       T00398                                 

Definition
(GenBank) Glutathione S-transferase, C-terminal domain protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bamb_3323
Enzymes [BR:bam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bamb_3323
Transporters [BR:bam02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bamb_3323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:complement(114431..115156)
Genome map
AA seq 241 aa AA seqDB search
MRYELYYWPEIQGRGEYVRLALEAAEADYVDVARESGRGMGVSAMMRMMDSTKDECVPFA
PPFLKAGDVVVGQVANILLFLGARLGLAPDDEAGRLWVHQLQLTVADFVTEIHDTHHPIG
SGLYYEDQKAEAAERAADFLEHRLPKYLGYFDRVLAQNPHKGGYLAGSALSYADLSIFQL
IEGLRYAFPKAMKRAERKVEGLVGLHDRVAQHPPIVRYLESKRRIPFNDMGIFRHYPELD
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatgaactctattactggcccgagatccagggccgcggcgaatacgtgcggctc
gcgctcgaggcggccgaggccgactatgtcgacgtcgcgcgcgaatcggggcgcggcatg
ggcgtgtcggcgatgatgcgcatgatggacagcacgaaggacgaatgcgtgccgttcgcg
ccgccgttcctgaaggccggcgacgtggtcgtcgggcaggtcgcgaacatcctgctgttt
ctcggcgcgcggctcgggctcgcgcccgatgacgaagccgggcgactgtgggtgcatcag
ctccagctgacggtcgccgatttcgtcaccgagatccacgacacacatcacccgatcggc
agcggcttgtactacgaagaccagaaggccgaggccgccgagcgcgcggccgacttcctc
gagcaccggctgccgaaatacctcggctacttcgatcgcgtgctcgcgcagaatccgcac
aagggcggctatctcgccggcagcgcgctcagttacgcggacctgtcgatattccagctg
atcgaaggcctgcgctacgcgtttccgaaggcgatgaagcgcgcggagcgcaaggtcgag
gggctcgtcggcctgcacgatcgcgtcgcgcagcatccgccgatcgtgcgttatctcgag
tccaagcgccgcatcccgttcaacgacatggggatcttccggcactatccggagctcgac
aaatag

DBGET integrated database retrieval system