KEGG   Burkholderia ambifaria AMMD: Bamb_5610Help
Entry
Bamb_5610         CDS       T00398                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD phosphoesterase module / ATP-dependent DNA ligase LigD polymerase module
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bam00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Bamb_5610
Enzymes [BR:bam01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Bamb_5610
DNA repair and recombination proteins [BR:bam03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Bamb_5610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:complement(44306..47104)
Genome map
AA seq 932 aa AA seqDB search
MAGKLDPYRRKRHFGATPEPEGAHGHHAKAGAKPAARASARGTHPLRFVIQEHHARRLHY
DFRLELDGTLKSWAVPKGPSFDPSVKRLAVHVEDHPLEYASFEGQIPEGHYGAGSVVVWD
EGTWTPDGGVAQAREGYRAGKLTFRLDGEKLHGGWALVRSGRQEGRQEQWLLIKERDDDA
RSMDEFDVVGERPGSVHDGAASARADAKNGSARGSRSGQREKSGTSAARHDDHRHDGHAG
TPIDPSRIEGAVRAPLPEHVAPQLATLVDGPPTQGDWCYELKFDGYRILARISGKGARRH
VKLMTREGRDWTAKLRAQRDALAALDVDAAWLDGEAVVLGKNGLPDFQALQNAFGGGHSD
EITLFVFDLPYLDGYDLRDAPLTARRALLEPLFADSDPTRLRFSPDLGNDVASLIASACD
TGLEGLIGKRAESRYRAGRSPAWIKLKCRRRQEFVIGGYTEPSGSRHGFGALLLGVHEPA
ADGKRRRGPGPLRYVGRVGTGFDTRMLDRLTPILRKHERDTMPFDPPPRERSRTPVHWIE
PVLVAECEFAEWTGDGIVRQAAFIALREDKPAARIVREVPKHTETEVQMEQRQTTRHERH
KPKGAARAERDTSDASDGKHPARSRGSRRAEADDTGPDQLGRVRISHPERVIDSHSGTRK
IDLARYWQWVAPWLLRDLKGRPVSLVRAPGDISGELFFQKHAERREIPFVTQHEGLDPGH
GPLLSLDSVDALLGAAQMGTIELHTWNAHASNIERPDRIVFDLDPDPALPWSAMIDAAQL
VRGLLDELGLISFCKTSGGKGLHVVVPITRHMGWDEVKDFSRAVAQHVAGALPDRFTATM
GPKHRRGKIFIDYLRNGRGASTIAAYSVRARPGLGVSVPLRWDEVPDTTGGAQWTIDTLH
ERLDRLKRDPWDGYDDTRQRITAQMRARLGTS
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaagctcgatccgtatcggcgcaagcgccacttcggcgcgacgccggaaccc
gaaggcgcgcacgggcatcatgcgaaggccggtgcgaagcccgccgcgcgcgcgagcgca
cggggcactcacccgctgcgcttcgtgatccaggagcaccacgcgcggcgactgcactac
gactttcggctcgaactcgatggcacgctgaagtcgtgggccgtgccgaaggggccgagc
ttcgatccgtcggtgaagcgcctcgcggtgcacgtcgaggaccatccgctcgaatacgcg
tcgttcgaaggccagattccggagggccattacggcgcgggctcggtcgtcgtatgggac
gaaggcacgtggacgcccgatggcggggttgcgcaggcacgcgaaggctatcgcgcgggc
aagctgacgttccggctcgatggcgaaaagctgcacggcggctgggcgctcgtgcgcagc
gggcggcaggaggggcggcaggagcagtggctgctgatcaaggagcgcgacgacgacgcg
cgcagcatggacgaattcgacgtcgtcggcgagcggccgggcagtgtgcacgacggcgcg
gcgtcggcgcgggcggacgcgaagaacggctcggcgcgcgggtcgcgaagcgggcagcgc
gagaagtccggcacatccgcggcgcggcatgacgaccaccggcacgacggccacgccggc
acgcccatcgacccttcccggatcgaaggcgcggtgcgcgcgccgctgcccgagcacgtc
gcgccgcaactcgcgacgctggtcgacggtccgccgacgcagggcgactggtgctatgaa
ctgaagttcgacggctaccggatccttgcgcgcatttccggcaagggcgcgcgccggcat
gtgaagctgatgacgcgcgaaggccgcgactggaccgcgaagctgcgcgcgcaacgcgat
gcgctcgcggcgctcgacgtcgacgccgcgtggctcgacggcgaggccgtcgtgctcggc
aagaacggcctgcccgatttccaggcgttgcagaacgcattcggcggcgggcattcggac
gagatcacgctgttcgtgttcgacctgccttatctcgacggttacgacctgcgcgacgcg
ccgctcaccgcgcgccgcgcgttgctcgaacccttgttcgccgacagcgaccccacgcgg
ctgcgcttttcgcccgatctcggcaacgacgtcgcatcgctgatcgcgagcgcatgcgac
accggcctcgaagggctgatcggcaagcgcgccgagtcgcgctatcgcgccggacgctcg
cccgcgtggatcaagctcaagtgccggcgccggcaggagttcgtgatcggcggctatacc
gagccgtcgggcagccggcacggcttcggcgcgctgctgctcggcgtgcacgaaccggcc
gcggacggcaagcggcggcgcgggccggggccgttgcgctacgtcggccgcgtcggcacc
ggcttcgacacgcggatgctcgaccggcttacccccatcctgcgcaagcacgaacgcgac
acgatgccgttcgatccgccgccgcgcgaacgctcgcgcacgcccgtgcactggatcgag
ccggtgctcgtcgccgaatgcgaattcgcggaatggaccggcgacggcatcgtgcggcag
gccgcgttcatcgcgctgcgcgaggacaagccggcggcacggatcgtccgcgaggtgccg
aagcatacggaaacggaggtgcagatggaacagcgtcaaaccacgcggcacgaaaggcac
aaacccaagggcgcggcgcgcgcggagcgcgacacgagcgacgcaagcgatggcaaacac
cccgcacgttcccgcggctcccgtcgcgccgaggccgacgataccggccccgaccagctc
ggccgcgtgcgcatcagccatccggagcgcgtgatcgactcgcacagcggcacgcgcaag
atcgatctcgcgcgctactggcaatgggtcgcgccgtggctgctgcgggacctgaagggt
cgccctgtgtcgctcgtgcgcgcaccgggcgacatctcgggcgagctgttcttccagaag
cacgcggagcgccgcgagatcccgttcgtcacgcaacacgaagggctcgatccgggccat
ggcccgctgctgtcgctcgacagcgtcgatgcgctgctcggtgccgcgcaaatgggcacg
atcgagctgcatacgtggaatgcgcacgcgtcgaacatcgagcggcccgaccggatcgtg
ttcgacctcgatcccgatccggcgctgccgtggagcgcgatgatcgacgccgcgcagctc
gtgcgcgggctgctcgacgaactcggcctcatctcgttctgcaagacgagcggcggcaag
gggctgcacgtcgtcgtgccgatcacgcggcacatgggatgggacgaagtgaaggatttc
tcgcgcgcggtcgcgcagcatgtcgcgggtgcgttgcccgatcgcttcaccgcgacgatg
ggcccgaagcaccggcgcggcaagatcttcatcgactacctgcgcaacggccgcggcgcg
agcacgatcgccgcgtattcggtgcgcgcgcggcccgggctcggcgtgtcggtgccgctg
cgctgggacgaggtgcccgacacgacgggcggcgcgcaatggacgatcgacacgctgcac
gagcgcctcgatcgactgaagcgcgatccgtgggacggctatgacgacacgcgccagcga
atcaccgcacaaatgcgcgcgcggctcggcacgtcgtga

DBGET integrated database retrieval system