KEGG   Bacillus velezensis UCMB5036: BAM5036_2253Help
Entry
BAM5036_2253      CDS       T02480                                 

Gene name
sodA
Definition
(GenBank) Manganese superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
baml  Bacillus velezensis UCMB5036
Brite
Enzymes [BR:baml01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BAM5036_2253 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2445976..2446581)
Genome map
AA seq 201 aa AA seqDB search
MAYKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGSALAEKSVDELVADL
NAVPEDIRTAVRNNGGGHANHSLFWTLLSPNGGGEPTGELAEEIKSTFGSFDQFKEKFAA
AAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPVLGLDVWEHAYYLNYQNRRPDY
ISAFWNVVNWDEVARLYSEAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaaacttccagaattgccttacgcttatgatgctttagaacctcatatcgat
aaggaaacgatgacgattcaccatacgaagcaccataacacatacgtgacaaacctcaac
aaagcgatcgaaggatctgcgcttgcagagaaatctgtagatgagcttgttgctgatttg
aacgcagtgccggaggacatccgcacggcagtccgcaacaatggcggcggacatgcaaac
cactctttattctggactcttttatctccgaacggcggaggcgaaccgactggtgagctt
gctgaagagatcaaaagcacgttcggaagcttcgatcaatttaaagaaaaattcgccgca
gcagctgcaggccgtttcggttcaggctgggcttggctcgttgtaaacaacggcaaactt
gaaattacaagcacgccaaaccaagattcaccgctttcagaaggtaaaacacctgttctc
ggtcttgatgtttgggagcacgcgtactacctgaactaccaaaaccgccgtcctgattac
atttcagctttctggaatgttgtgaactgggatgaagttgcccgtctttacagcgaagca
aaataa

DBGET integrated database retrieval system