KEGG   Bacillus velezensis TrigoCor1448: AJ82_02695Help
Entry
AJ82_02695        CDS       T03161                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bamt  Bacillus velezensis TrigoCor1448
Pathway
bamt00473  D-Alanine metabolism
bamt00550  Peptidoglycan biosynthesis
bamt01100  Metabolic pathways
bamt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bamt00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AJ82_02695 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AJ82_02695 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AJ82_02695 (ddl)
Enzymes [BR:bamt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AJ82_02695 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bamt01011]
 Precursor biosynthesis
  Amino acid ligase
   AJ82_02695 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AHK48079
LinkDB All DBs
Position
486350..487435
Genome map
AA seq 361 aa AA seqDB search
MKTSLGLVYGGKSAEHNVSLQTALAVTKALNTEKFDIHPIYITEKGEWQRGPLLTEPVSN
VKMLQLEQNGESFALSALNREMFPEASPDEKAPIDVVFPLLHGPNGEDGTIQGLLELLNV
PYVGNGVLASSAGMDKVIMKHLFAQAGLPQAKYAAFLKKDWKQTPDSCLQQVEKELGYPC
FVKPANLGSSVGISKCRNREELEKAFELAFEYDRKIVVEEGIAGREIEIGVLGNDEPKCS
AVGEIAPKTDFYDYKAKYEDGDTDLMIPAQVTDEQYAEISEMAIKAFKAIDGSGLVRADF
FLTNDGQVLINEVNTMPGFTPFSMFPLLWKEAGVDYSDLIEQLVELAKERHAEKQLIKHT
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacaagtctaggattggtgtacggcggaaagtcagccgaacacaatgtatcgctg
cagacagcattagctgtaacaaaagcgcttaatactgagaagtttgatatacatccgatt
tacatcactgaaaaaggagaatggcaaagaggcccgctgctgactgagccggtttccaac
gtgaaaatgcttcagctggaacaaaacggtgaaagtttcgctctatcagcattgaaccgg
gaaatgtttcctgaagcgtcgcctgacgaaaaggcgccgatcgatgtcgtatttccgctt
ctccacggaccgaacggtgaagacggcaccattcagggtctgctggaattgctgaacgtt
ccttatgtcggcaacggggtgcttgcatcatcagccggcatggataaagtcatcatgaag
catttgttcgctcaagcggggcttccgcaggcgaagtacgccgctttcttaaaaaaggac
tggaaacagacgccggacagctgcttacagcaggttgaaaaggagctgggatatccgtgc
ttcgtcaaaccggcgaacctcggatcaagcgtcggaatcagcaaatgccgaaaccgtgaa
gagcttgaaaaagccttcgaactggcttttgagtatgaccggaaaattgtggtggaagaa
ggaatcgccggcagagaaatcgaaatcggcgtgctcggaaatgacgaaccgaaatgttcc
gccgtcggtgaaatcgctccgaagaccgacttttacgattacaaagcgaaatatgaagac
ggcgacacggatttaatgattcccgcgcaagtgacggatgaacaatatgcggaaatcagc
gaaatggcgattaaagccttcaaagcgattgacggatcaggccttgtccgcgccgatttc
ttcctgaccaatgacggtcaagtgctcattaacgaagtgaacacaatgccgggctttacg
ccattcagcatgttcccgctgctttggaaagaagcaggtgtagattacagtgatctgatc
gaacagctggttgagctggcaaaagaacgccatgccgaaaaacagctgattaaacataca
ttttaa

DBGET integrated database retrieval system