KEGG   Bacillus velezensis TrigoCor1448: AJ82_13200Help
Entry
AJ82_13200        CDS       T03161                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bamt  Bacillus velezensis TrigoCor1448
Brite
Enzymes [BR:bamt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AJ82_13200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2493691..2494299)
Genome map
AA seq 202 aa AA seqDB search
MMAYKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGSALAEKSVDELVAD
LNAVPEDIRTAVRNNGGGHANHSLFWTLLSPNGGGEPTGELAEEIKSTFGSFDQFKEKFA
AAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPVLGLDVWEHAYYLNYQNRRPD
YISAFWNVVNWDEVARLYSEAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
attatggcttacaaacttccagaattgccttacgcttatgatgctttagaacctcatatc
gataaggaaacgatgacgattcaccatacgaagcaccataacacatacgtgacaaacctc
aacaaagcgatcgaaggatcagcgcttgcagagaaatctgtagatgagcttgttgctgat
ttgaatgcagtgccggaggacatccgcacggcagtccgcaacaatggcggcggacatgca
aaccactctttattctggactcttttatctccgaacggcggaggcgaaccgactggtgag
cttgctgaagagatcaaaagcacgttcggaagcttcgatcaatttaaagaaaaattcgcg
gcagcagctgcaggccgtttcggttcaggctgggcttggctcgttgtaaacaacggcaaa
cttgaaattacaagcacgccaaaccaagattcaccgctttcagaaggtaaaacacctgtt
ctcggccttgatgtttgggagcacgcgtactacctgaactaccaaaaccgccgtcctgat
tacatttcagctttctggaatgttgtgaactgggatgaagttgcccgtctttacagcgaa
gcaaaataa

DBGET integrated database retrieval system