KEGG   Bacillus velezensis SQR9: V529_02910Help
Entry
V529_02910        CDS       T03384                                 

Gene name
amyE
Definition
(GenBank) AmyE
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bamy  Bacillus velezensis SQR9
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    V529_02910 (amyE)
Enzymes [BR:bamy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     V529_02910 (amyE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
285419..287398
Genome map
AA seq 659 aa AA seqDB search
MFEKRFKTSLLPLFAGFLLLFYLVLSGPAAANAETANKSNKVTASSVKNGTILHAWNWSF
NTLTQNMKDIRDAGYAAIQTSPINQVKEGNQGDKSMRNWYWLYQPTSYQIGNRYLGTEQE
FKDMCAAAEKYGVKVIVDAVINHTTSDYGAISDEIKRIPNWTHGNTQIKNWSDRWDVTQN
SLLGLYDWNTQNTEVQAYLKRFLERALNDGADGFRYDAAKHIELPDDGNYGSQFWPNIAN
TSAEFQYGEILQDSASRDTAYANYMNVTASNYGHSIRSALKNRNLSVSNISHYASDVSAD
KLVTWVESHDTYANDDEESTWMSEDDIRLGWAVIGSRSGSTPLFFSRPEGGGNGVRFPGK
SQIGDRGSALFKDQAITAVNTFHNVMAGQPEELSNPNGNNQIFMNQRGSKGVVLANAGSS
SVTINTSTKLPDGRYDNRAGAGSFQVANGKLTGTINARSAAVLYPDDIGNAPHVFLENYQ
TGAVHSFNDQLTVTLRANAKTTKAVYQINNGQQTAFKDGDRLTIGKGDPIGTTYNIKLTG
TNVEGAARTQEYTFVKKDPAQTNIIGYQNPDHWGQVNVYIYKHDGGRAIELTGSWPGKAM
TKNANGIYTLTLPANADTANAKVIFNNGSAQVPGQNQPGFDYVQNGLYNNSGLNGYLPH
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaaacgattcaaaacctctttactgccgttattcgccggatttttattgctg
ttttatttggttttgtcaggcccggcggctgcaaacgctgaaactgcaaacaaatcgaat
aaggtgaccgcgtcatcggtcaaaaacgggaccatccttcatgcatggaattggtcgttc
aatacgttaacacaaaatatgaaagatattcgtgatgcgggctatgcagccattcagacg
tctccgattaaccaagtaaaggaagggaaccaaggagataaaagcatgaggaactggtac
tggctgtatcagccgacatcgtaccaaatcggcaaccgttacttaggcactgaacaagaa
tttaaggacatgtgtgcagccgcggaaaaatatggcgtaaaagtcattgtcgatgcggtt
atcaatcatactaccagcgattatggcgcgatttctgacgagattaagcgtattccaaac
tggacccatggaaacacacaaattaaaaattggtcggatcgatgggacgtcactcaaaat
tcattgcttgggctgtatgattggaatacacagaatactgaggtgcaggcctatctgaaa
cgtttcttggaaagagcattgaatgacggagcagacgggttccgctatgatgccgccaag
catatagagcttccggatgatgggaattacggcagccaattttggccgaatatcgcaaat
acatcagcggagttccaatacggagaaatcctgcaagacagcgcgtccagagatacagct
tatgcgaattatatgaatgtgacggcttctaactacgggcattccatcagatccgcttta
aagaaccgtaatctgagtgtgtcgaatatctcccattatgcatctgacgtgtctgcggac
aagttagtcacatgggtggaatcacatgatacgtatgccaatgatgatgaagagtccaca
tggatgagtgaggacgatattcgtttaggctgggcagtgattggttcccgctcaggaagc
acgcctcttttcttttccagacctgagggcggaggaaatggtgtaagatttcccggaaaa
agtcaaataggagatcgcgggagcgccttatttaaagatcaggcgatcactgcggtcaat
acatttcacaatgtaatggccgggcagcctgaggaactctcgaatccgaatgggaacaac
caaatctttatgaatcagcgcggctcaaaaggcgttgtgctggcaaatgcaggatcgtct
tctgtcaccatcaatacttcaacgaaattacctgacggcaggtatgataatagggccggc
gccggttcatttcaagtagcgaacggcaaactgacaggtacgatcaatgccagatcggcg
gctgttctttatcctgatgatattgggaatgcgcctcatgtctttcttgagaattaccaa
acgggggcagtccattctttcaatgatcagctgacggtcaccctgcgtgcaaatgcgaaa
acaacaaaagccgtttaccaaatcaataatgggcagcagacagcatttaaggatggggac
cgattaacgatcgggaaaggagatccaatcggcacgacatacaacatcaagttaaccgga
acgaacgtcgagggtgcagcgagaacccaagaatacacgtttgtcaaaaaagacccggcc
caaaccaacatcattggctatcaaaatccggatcattggggccaggtaaatgtatatatt
tacaaacatgatggaggcagggccatagaattaaccggatcgtggcccgggaaagcaatg
actaagaatgcaaatggaatttacacgctgacgctgcctgcgaatgcggatacggccaat
gccaaagtgatttttaacaatggcagcgcccaagtgcccggacagaaccagcccggcttt
gattatgtgcagaatggtttgtataacaactccggtttaaacggttatcttccgcattaa

DBGET integrated database retrieval system