KEGG   Bacillus anthracis Ames: BA_5139Help
Entry
BA_5139           CDS       T00129                                 

Gene name
sodC
Definition
(RefSeq) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ban  Bacillus anthracis Ames
Brite
Enzymes [BR:ban01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BA_5139 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 1084508
NCBI-ProteinID: NP_847325
LinkDB All DBs
Position
complement(4667476..4668015)
Genome map
AA seq 179 aa AA seqDB search
MKKRLFFSCCLLFLMAGCDQGKPKEIDVKLHNASGDEVGTAKVTQQTSGVKITIKGEGFA
PGPHGLHVHEIGECKAPRFESAGNHFNPDDKKHGLLNPKGAENGDLPNVIADGSGKIKAE
IDAPHITLEEGKTTIHRKDGASIIITENADDGMTQPTGKSGDRIACGVIVKKASDMKKK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacggctttttttcagttgttgtttactatttctgatggcaggttgtgaccaa
ggaaagccgaaagaaattgacgtgaaattacataatgcttcaggtgatgaagtggggact
gcgaaagtaactcagcaaacaagcggagtgaaaattacgattaaaggggaaggtttcgcg
ccaggcccgcacggactacatgtacacgaaattggagagtgtaaagcacctcgttttgaa
tcagctggaaatcattttaatccagatgataaaaagcatggactacttaatccgaagggt
gcagaaaacggtgatttaccgaacgtaattgcagacggttctgggaaaattaaagcagaa
attgatgcaccgcatataacgcttgaagaaggaaaaacgacgattcatagaaaagatgga
gcgtctattattattacggaaaacgctgatgatggtatgacacaaccgacaggtaaatca
ggtgatcgaattgcttgtggtgtcattgtaaaaaaagcgtcggatatgaagaaaaagtaa

DBGET integrated database retrieval system