KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_1635Help
Entry
BAMF_1635         CDS       T01321                                 

Gene name
amyA
Definition
(GenBank) AmyA
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00500  Starch and sucrose metabolism
bao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BAMF_1635 (amyA)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BAMF_1635 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: CBI42761
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1636555..1638099
Genome map
AA seq 514 aa AA seqDB search
MIQKRKRTVSFRLVLMCTLLFVSLPITKTSAVNGTLMQYFEWYTPNDGQHWKRLQNDAEH
LSDIGITAVWIPPAYKGLSQSDNGYGPYDLYDLGEFQQKGTVRTKYGTKSELQDAIGSLH
SRNVQVYGDVVLNHKAGADATEDVTAVEVNPANRNQETSEEYQIKAWTDFRFPGRGNTYS
DFKWHWYHFDGADWDESRKISRIFKFRGEGKAWDWEVSSENGNYDYLMYADVDYDHPDVV
AETKKWGIWYANELSLDGFRIDAAKHIKFSFLRDWVQAVRQATGKEMFTVAEYWQNNAGK
LENYLNKTSFNQSVFDVPLHFNLQAASSQGGGYDMRRLLDGTVVSRHPEKAVTFVENHDT
QPGQSLESTVQTWFKPLAYAFILTRESGYPQVFYGDMYGTKGTSPKEIPSLKDNIEPILK
ARKEYAYGPQHDYIDHPDVIGWTREGDSSAAKSGLAALITDGPGGSKRMYAGLKNAGETW
YDITGNRSDTVKIGSDGWGEFHVNDGSVSIYVQK
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaaacgaaagcggacagtttcgttcagacttgtgcttatgtgcacgctgtta
tttgtcagtttgccgattacaaaaacatcagccgtaaatggcacgctgatgcagtatttt
gaatggtatacgccgaacgacggccagcattggaaacgattgcagaatgatgcggaacat
ttatcggatatcggaatcactgccgtctggattcctcccgcatacaaaggattgagccaa
tccgataacggatacggaccttatgatttgtatgatttaggagaattccagcaaaaaggg
acggtcagaacgaaatacggcacaaaatcagagcttcaagatgcgatcggctcactgcat
tcccggaacgtccaagtatacggagatgtggttttgaatcataaggctggtgctgatgca
acagaagatgtaactgccgtcgaagtcaatccggccaatagaaatcaggaaacttcggag
gaatatcaaatcaaagcgtggacggattttcgttttccgggccgtggaaacacgtacagt
gattttaaatggcattggtatcatttcgacggagcggactgggatgaatcccggaagatc
agccgcatctttaagtttcgtggggaaggaaaagcgtgggattgggaagtatcaagtgaa
aacggcaactatgactatttaatgtatgctgatgttgactacgaccaccctgatgtcgtg
gcagagacaaaaaaatggggtatctggtatgcgaatgaactgtcattagacggcttccgt
attgatgccgccaaacatattaaattttcatttctgcgtgattgggttcaggcggtcaga
caggcgacgggaaaagaaatgtttacggttgcggagtattggcagaataatgccgggaaa
ctcgaaaactacttgaataaaacaagctttaatcaatccgtgtttgatgttccgcttcat
ttcaatttacaggcggcttcctcacaaggaggcggatatgatatgaggcgtttgctggac
ggtaccgttgtgtccaggcatccggaaaaggcggttacatttgttgaaaatcatgacaca
cagccgggacagtcattggaatcgacagtccaaacttggtttaaaccgcttgcatacgcc
tttattttgacaagagaatccggttatcctcaggtgttctatggggatatgtacgggaca
aaagggacatcgccaaaggaaattccctcactgaaagataatatagagccgattttaaaa
gcgcgtaaggagtacgcatacgggccccagcacgattatattgaccacccggatgtgatc
ggatggacgagggaaggtgacagctccgccgccaaatcaggtttggccgctttaatcacg
gacggacccggcggatcaaagcggatgtatgccggcctgaaaaatgccggcgagacatgg
tatgacataacgggcaaccgttcagatactgtaaaaatcggatctgacggctggggagag
tttcatgtaaacgatgggtccgtctccatttatgttcagaaataa

DBGET integrated database retrieval system