KEGG   Bathyarchaeota archaeon BA2: AOA66_1458Help
Entry
AOA66_1458        CDS       T04066                                 

Gene name
porA
Definition
(GenBank) Pyruvate synthase subunit PorA
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
barb  Bathyarchaeota archaeon BA2
Pathway
barb00010  Glycolysis / Gluconeogenesis
barb00020  Citrate cycle (TCA cycle)
barb00620  Pyruvate metabolism
barb00640  Propanoate metabolism
barb00650  Butanoate metabolism
barb00680  Methane metabolism
barb00720  Carbon fixation pathways in prokaryotes
barb01100  Metabolic pathways
barb01120  Microbial metabolism in diverse environments
barb01130  Biosynthesis of antibiotics
barb01200  Carbon metabolism
Module
barb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:barb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOA66_1458 (porA)
   00020 Citrate cycle (TCA cycle)
    AOA66_1458 (porA)
   00620 Pyruvate metabolism
    AOA66_1458 (porA)
   00640 Propanoate metabolism
    AOA66_1458 (porA)
   00650 Butanoate metabolism
    AOA66_1458 (porA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    AOA66_1458 (porA)
   00680 Methane metabolism
    AOA66_1458 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AOA66_1458 (porA)
Enzymes [BR:barb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     AOA66_1458 (porA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C Ribul_P_3_epim DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: KPV62089
UniProt: A0A0P9E1E6
LinkDB All DBs
AA seq 409 aa AA seqDB search
MAVAKQKMLALNGDEAVAYAVKQSDVDVVAAYPITPQTIIVERFSEYVADGEVDTEFVCV
ESEHSALTACLTAAATGARAFTATASAGLALMHEILYVTSGCRAPVVMAIVNRALSAPLN
IHCDHSDSMVERDCSWIQIYVENSQEAYDSIIQAFKIAENQELLLPVMVGLDGFTLSHTL
ENVQTLPDDLVKKFVGTRKFPLVTSHEGKNVPFKLDPKKPMTIGPIDLYDYYFEHKRQQE
EAMQIAPKIIQQVHKEYAKISGRRYGNGLIEPYHLEDAEMAIVCVGSTSGTVKTVVNELR
SKGTKVGLLRLRTFRPLPVKEITKALENVKAVAVMDRSLSFGGHGGAVFHEIRHVLYDAS
KHPYVVNYIYGLGGRDTSPNLIQKIYRDLQRILETQQIEKPVQFIGLRE
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgctaaacagaaaatgttagctttaaacggagacgaagcagttgcgtatgcc
gtgaaacaatcagatgtagatgttgtagcggcgtatccaataacgcctcagactataatt
gtggaacgattcagtgaatacgtagccgacggagaagttgacacagaatttgtttgtgtt
gaatctgaacatagcgcgttaaccgcatgtttaacagcggcagccacaggtgcgagagct
tttacagcaacagcttccgctggattagccttaatgcatgaaattttatacgtaacctca
ggatgtcgcgcacccgtagtaatggcaattgttaacagagctttatcagcaccactaaac
attcactgcgaccattcagacagcatggttgaacgcgactgtagctggatacagatttat
gtggaaaactcgcaagaagcatacgattctataattcaagctttcaaaatcgctgaaaac
caagagctcttgctaccagtaatggtaggactagacggtttcacattaagccacacatta
gaaaacgtgcaaacactgccagatgacttagtgaaaaagttcgttggaacgcgcaaattt
ccacttgtaaccagccatgaaggaaaaaatgtgcctttcaaacttgacccaaaaaaaccc
atgacaattggtcctatagacctatatgattactatttcgagcataagaggcaacaagaa
gaagccatgcagattgcccctaaaatcatccaacaagtgcataaagaatatgccaagata
agcgggagacgttacggaaacggattaattgaaccataccatcttgaagatgctgaaatg
gcaatagtctgcgtagggtcaacctccggaacagtcaaaaccgtcgtaaacgaacttaga
tcaaaaggaacaaaagtaggtttgctcaggcttcgcactttcagaccattaccagtaaag
gaaataaccaaagcattagaaaatgtgaaagcagtagctgttatggatagaagtctaagc
tttggaggacacggcggagcagtattccatgaaatacgccacgttttatacgacgcgtct
aagcatccctacgtagtgaactacatttacgggctcggtggaagagacacaagtccaaac
cttatacaaaaaatctaccgagacctgcaaagaatactagagactcaacagattgagaag
ccagtgcaatttattggattaagggagtga

DBGET integrated database retrieval system