KEGG   Belliella baltica: Belba_3245Help
Entry
Belba_3245        CDS       T02134                                 

Definition
(GenBank) BNR/Asp-box repeat protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
bbd  Belliella baltica
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Belba_3245
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Belba_3245
Enzymes [BR:bbd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Belba_3245
Bacterial toxins [BR:bbd02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Belba_3245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3487881..3489419)
Genome map
AA seq 512 aa AA seqDB search
MKKYKVFGLLTMIIGVMASVSCQSQKLESGKALSFEPRYVPLLQGGFSHVGSILLDGNTQ
AENGQLTLIINGNQEMDSVKLVARIGEKETQVLAKTAKVKGKTTLKLAALPSGAQSLEVH
VMANDTHDLKDKVNISVGNIMLDKKKIALNSTKEVSAYRLATALRSYGFEGVHSYRIPGL
VTTPKGTVLAVYDIRRNSSVDLQGDIDVGLSRSTDGGRTWEPMKVIMDIGEWGDLPEDQN
GIGDPAILVDHETGHIWVAALWQHGKPGKMAWNSSEQGMKPEETGQFMLVKSEDDGLTWS
EPINITQQMKDPKWHLFFNGPGKGITMQDGTLVFSAQYKDENNMPHSTIIYSKDKGKNWS
VGTGARSNTTEAQVVELADGTLMLNMRDNRGGSRAVAVTKDFGKTWTEHSTSRKDLIEPV
CMASIIDNPYIDQMLLFSNPAHEKRRVNMTIKASKDDGNTWPEDMQLLLDEGQGWGYSCL
TMINEKEVGILYESSVANITFQIIPLEDVLRK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtataaggtatttggattattgacgatgatcattggggtgatggctagcgtc
tcttgtcagtctcagaaactggaaagtggaaaggctctctctttcgaaccccgctatgta
ccgcttcttcagggaggttttagtcacgtgggaagtattcttttggatgggaatacccaa
gctgaaaatggccagttgactttgataatcaatgggaatcaggagatggacagcgtaaag
cttgtagcgagaattggagaaaaagaaacccaagtgctggccaaaacggctaaggtcaaa
ggcaagactactttaaagcttgccgctttaccctctggggcacaatccttggaagttcat
gtcatggccaatgatacccatgatttgaaagacaaggtcaatatttcggtaggaaatata
atgctggataaaaagaagattgctttaaacagcaccaaagaagtttctgcatacaggctg
gctacagccttgagaagttatggttttgaaggggtgcattcttacaggatacctggactg
gttactaccccaaagggaacagtactggcagtatatgatatcaggagaaatagctctgtg
gacttgcagggggatatcgatgtaggcctgagtagaagtacggatggcggaagaacctgg
gaacccatgaaagtgatcatggatattggcgaatggggagaccttcctgaagatcagaac
ggtattggagacccggctattttggtagaccatgaaaccggccatatctgggtggctgcc
ctatggcagcatggcaagcccgggaaaatggcctggaattcttccgaacagggtatgaag
cctgaagagaccggacagtttatgttggtgaagtcggaggatgatggtcttacatggtct
gaacccatcaatatcacacaacaaatgaaagaccccaaatggcaccttttcttcaacggt
cctggtaaaggtattaccatgcaggatggtactttggttttctcggctcaatacaaggac
gaaaataatatgcctcacagtaccattatttacagcaaagataaaggcaagaactggtct
gtaggtacgggagctagatccaataccaccgaagctcaagtcgtagagcttgctgatggt
actttaatgcttaatatgcgggacaaccgtggaggttcaagggcagtggcagtgaccaaa
gattttggaaaaacttggacagaacattcgacttccagaaaagatttgatagagcctgta
tgtatggcaagtatcattgataatccatacatagaccaaatgctgctattttccaatcct
gcacatgaaaaaagaagagtcaatatgaccatcaaagcaagtaaggatgacggcaatacc
tggccggaagacatgcagctgctgctggatgaagggcagggctggggctattcctgcctg
accatgatcaatgaaaaagaggtggggatactttacgaaagcagtgtggccaatattact
tttcagattattccattggaggatgttctgaggaaataa

DBGET integrated database retrieval system