KEGG   Bifidobacterium bifidum S17: BBIF_0507Help
Entry
BBIF_0507         CDS       T01328                                 

Definition
(GenBank) beta-galactosidase BbgIII
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BBIF_0507
  Lipid metabolism
   00600 Sphingolipid metabolism
    BBIF_0507
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BBIF_0507
Enzymes [BR:bbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BBIF_0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
623203..629010
Genome map
AA seq 1935 aa AA seqDB search
MAVRRLGGRIVAFAATVALSIPLGLLTNSAWAVEDATRSDSTTQMSSTPEVVYSSAVDSK
QNRTSDFDANWKFMLSDSVQAQDPAFDDSAWQQVDLPHDYSITQKYSQSNEAESAYLPGG
TGWYRKSFTIDRDLAGKRIAINFDGVYMNATVWFNGVKLGTHPYGYSPFSFDLTGNAKFG
EENTIVVKVENRLPSSRWYSGSGIYRDVTLTVTDGVHVGNNGVAIKTPSLATQNGGNVTM
NLTTKVANDTKAAANITLKQTVFPKGGKTDAAIGTVTTASKSIAAGASADVTSTITAASP
KLWSIKNPNLYTVRTEVLNGGKVLDTYDTEYGFRWTGFDATSGFSLNGEKVKLKGVSMHH
DQGSLGAVANRRAIERQVEILQKMGVNSIRTTHNPAAKALIDVCNEKGVLVVEEVFDMWN
RSKNGNTEDYGKWFGQAIAGDNAVLGGDKDETWAKFDLTSTINRDRNAPSVIMWSLGNEM
MEGISGSVSGFPATSAKLVAWTKAADSTRPMTYGDNKIKANWNESNTMGDNLTANGGVVG
TNYSNGANYDKIRTDHPSWAIYGSETASAINSRGIYNRTTGGAQSSDKQLTSYDNSAVGW
GAVASSAWYDVVQRDFVAGTYVWTGFDYLGEPTPWNGTVSGAVGSWPSPKNSYFGIVDTA
GFPKDTYYFYQSQWNDDVHTLHILPAWNENVVAKGSGNNVPVVVYTDAAKVKLYFTPKGS
TEKRLIGEKSFTKKTTAAGYTYQVYEGTDKDSTAHKNMYLTWNVPWAEGTISAEAYDENN
RLIPEGSTEGNASVTTTGKAAKLKADADRKTITADGKDLSYIEVDVTDANGHIVPDAANR
VTFDVKGAGKLVGVDNGSSPDHDSYQADNRKAFSGKVLAIVQSTKEAGEITVTAKADGLQ
SSTVKIATTAVPGTSTEKTVRSFYYSRNYYVKTGNKPILPSDVEVRYSDGTSDRQNVTWD
AVSDDQIAKAGSFSVAGTVAGQKISVRVTMIDEIGALLNYSASTPVGTPAVLPGSRPAVL
PDGTVTSANFAVHWTKPADTVYNTAGTVKVPGTATVFGKEFKVTATIRVQRSQVTIGSSV
SGNALRLTQNIPADKQSDTLDAIKDGSTTVDANTGGGANPSAWTNWAYSKAGHNTAEITF
EYATEQQLGQIVMYFFRDSNAVRFPDAGKTKIQISADGKNWTDLAATETIAAQESSDRVK
PYTYDFAPVGATFVKVTVTNADTTTPSGVVCAGLTEIELKTATSKFVTNTSAALSSLTVN
GTKVSDSVLAAGSYNTPAIIADVKAEGEGNASVTVLPAHDNVIRVITESEDHVTRKTFTI
NLGTEQEFPADSDERDYPAADMTVTVGSEQTSGTATEGPKKFAVDGNTSTYWHSNWTPTT
VNDLWIAFELQKPTKLDALRYLPRPAGSKNGSVTEYKVQVSDDGTNWTDAGSGTWTTDYG
WKLAEFNQPVTTKHVRLKAVHTYADSGNDKFMSASEIRLRKAVDTTDISGATVTVPAKLT
VDRVDADHPATFATKDVTVTLGDATLRYGVDYLLDYAGNTAVGKATVTVRGIDKYSGTVA
KTFTIELKNAPAPEPTLTSVSVKTKPSKLTYVVGDAFDPAGLVLQLNYDDDSTGTVTWNT
QTAGDFTFKPALDAKLKVTDKTVTVTYQGKSAVIDITVSQPAPTVSKTDLDKAIKAIEAK
NPDSSKYTADSWKTFADAMAHAKAIIADDSATQQDVDNALKALTDAYAGLTEKTPEPAPV
SKSELDKKIKAIEAEKLDGSKYTAESWKAFETALAHAKAVIASDSATQQDVDAALGALTS
ARDGLTEKGEVKPDPKPEPGTVDKAALDKAVKKVEAEKLDGSKYTAESWKAFETALAHAK
AVIGNANSTQFDIDNALSMLNDARAALKEKPGRIIAIIDGSALSKTGASVASIASVAAAM
LAVGAGVMALRRKRF
NT seq 5808 nt NT seq  +upstreamnt  +downstreamnt
atggcagttcgcagacttggtggccgcatcgtggctttcgccgccacagtggccttgtca
ataccgttagggttgttaacaaattcagcgtgggcggtcgaggacgccacccgatccgac
tccaccacgcagatgagctccacgccggaggtggtctactccagcgccgtggattccaag
cagaatcgcacctcggatttcgacgccaactggaagttcatgctgtccgattccgtgcag
gcgcaggatccggcgttcgacgattcggcctggcagcaggtcgacctgccgcatgactac
agcatcacgcagaagtattcgcagagcaacgaggccgaaagcgcataccttcccggcggc
accggctggtaccgcaagtccttcaccatcgaccgggacctcgccggcaagcgcatcgcc
atcaacttcgacggcgtgtacatgaacgccaccgtctggttcaacggcgtcaagctcggc
acccatccgtacggctactcgccgttctccttcgacctgaccggcaacgccaagttcggc
gaggagaacaccatcgtcgtcaaggtcgagaacaggctgccgtccagccgctggtactcc
ggctccggcatctaccgcgacgtcaccctcaccgtcaccgacggcgtgcacgtcggcaat
aacggcgtggccatcaagaccccgagcctcgccacccaaaacggcggcaacgtgacgatg
aacctcaccaccaaggtcgccaacgacaccaaggccgcggcaaacatcaccctcaagcag
accgtgttccccaagggaggcaagaccgacgccgccatcggcaccgtcaccaccgcatcc
aagtccatcgcggccggtgccagcgcggacgtgacctccacgatcaccgccgcctcgccc
aagctgtggagcatcaagaacccgaacctgtacaccgtgcgcaccgaagtgctcaacggc
ggcaaggtgctcgacacttacgacaccgaatatggcttccgctggaccggcttcgatgcg
accagcggtttctcgctcaacggcgagaaagtcaagctcaagggcgtctcaatgcatcat
gaccagggatcgcttggtgcggtcgccaaccgccgcgccatcgagcgccaggtcgagatt
ctccagaagatgggcgtcaactcgatccgcaccacgcacaaccccgcagccaaggcgctg
attgacgtctgcaacgagaagggcgtcctcgtggtcgaagaggtcttcgacatgtggaac
cggtcgaagaacggcaacaccgaggattacggcaagtggttcggccaggccatcgccggt
gacaacgccgtcctgggtggcgacaaggacgagacctgggccaagttcgacctgaccagc
accatcaaccgtgacaggaacgccccgtccgtcatcatgtggtcgctcggcaacgagatg
atggaaggcatcagcggcagcgtctcgggcttcccggctacctccgccaagctggtcgca
tggacgaaggccgcggacagcacccgcccgatgacctacggcgacaacaagatcaaggcc
aactggaacgagtcgaacacgatgggcgacaacctgaccgccaacggcggcgtggtcggc
accaactactccaacggcgcgaactacgacaagatccgcacggaccacccctcatgggcc
atctacggttccgagacggcgtccgccatcaacagccgaggcatctacaaccgcaccacc
ggcggcgcccagtcaagcgacaagcagctgaccagctatgacaattccgcagtcggctgg
ggcgccgtcgccagctccgcctggtacgacgtggtccagcgcgatttcgtcgccggcaca
tacgtgtggaccggcttcgactacctcggcgaacccaccccgtggaacggcaccgtctcc
ggcgccgtgggctcctggccgtcgccgaagaactcgtacttcggcatcgtcgacaccgca
ggattcccgaaggacacctattacttctatcagagccagtggaacgacgacgtgcacacg
ctgcacatcctccccgcatggaacgagaacgtcgtcgccaagggctccggcaacaacgtg
ccggtcgtcgtctacaccgacgcggccaaggtcaagctgtacttcacaccgaagggcagc
accgaaaagcgactgatcggagagaagtccttcaccaagaagaccaccgcggccggatac
acctatcaggtctatgagggcaccgacaaggactccaccgcccacaagaacatgtacctg
acctggaacgtgccgtgggccgagggcaccatctccgccgaagcatacgacgagaacaac
aggctgatccccgaggggtccaccgagggcaacgcgtcggtgaccaccaccggcaaggcc
gcgaagcttaaagccgatgccgaccgcaagacgatcaccgcggacggcaaggacctgtcg
tacatcgaggtcgacgtgaccgacgccaacggccatatcgtccccgatgccgccaaccgc
gtcaccttcgacgtcaagggcgccggcaaactggtcggcgtcgacaacggcagctcgccg
gatcacgactcctatcaggccgacaaccgcaaggcgttcagcggcaaggtgctcgccatc
gtccagtccaccaaggaggcgggcgagatcaccgtcaccgccaaggccgacggtctgcaa
tcatccacagtgaagatcgccaccaccgccgtccccggcaccagcaccgagaagacggtc
cgcagcttctactactcgcgcaactactacgtcaagaccggcaacaagccgattctgccg
agtgatgtcgaggtgcgctactccgacggcacgtcggaccgtcagaacgtcacatgggac
gcagtcagcgacgaccagatcgccaaggccggttcgttcagcgtggccggcacggtcgcc
gggcagaagatctccgtgcgcgtgacgatgatcgacgagatcggtgcgctgctcaactat
tcggccagcacaccggtcggcacgcccgccgtgctgcctggctcgcgtccggccgtgctg
cccgacggcaccgtgaccagcgcgaacttcgctgtccactggaccaagcccgccgacacc
gtgtacaacacggccggcaccgtcaaggtccccggcaccgccaccgtcttcggcaaggag
ttcaaggtcaccgcgacgattcgcgtgcagcggtcgcaggtcaccatcggcagcagcgtc
tccggcaatgcgctgcgcctgactcagaacatccccgccgacaagcagtccgacacgctg
gacgccatcaaggacggctccacgaccgtcgacgccaataccggcggcggcgcgaacccg
tcagcatggaccaactgggcgtactcgaaggccggccacaacaccgccgagatcaccttc
gagtacgcgaccgagcagcagctcggccagattgtcatgtacttcttccgcgacagcaac
gcggtgaggttccccgacgccggcaagacgaagatccagatctccgcggacggcaagaac
tggacggatctcgctgccacggagaccatcgcggcccaggagtcgtccgaccgagtcaag
ccgtacacctatgacttcgctccggtgggagccacgttcgtcaaggtcacggtcaccaac
gccgacaccacaacccccagcggcgtggtctgcgccggcctgaccgagatcgagctgaag
accgcgaccagcaagttcgtcacgaacacgtccgccgcgctctcgtcgctgacagtgaac
ggcacgaaggtctccgactccgtgctcgccgccggctcctacaacacgcccgcgatcatc
gcggacgtcaaagccgagggcgaaggcaacgccagcgtcaccgtgctgcccgcgcacgac
aacgtgatccgcgtgatcaccgagtccgaggaccacgtcacgcgcaagaccttcaccatc
aacctgggcacggagcaggaattccccgcagactccgatgaacgcgactacccggccgcc
gacatgacggtcaccgtgggcagcgaacagacgtccggcaccgcgaccgaaggcccgaag
aaattcgcggtcgacggcaacaccagcacgtactggcattccaactggacgcccaccacc
gtgaacgacctgtggatcgccttcgagctccagaaacccaccaagctcgacgcgctgcgc
tacctgccgcgccccgcgggcagcaagaacggctccgtcaccgaatacaaggttcaggtc
agcgatgacggcaccaactggaccgacgcgggctccggcacatggaccaccgattacggc
tggaagctcgccgagttcaatcagccggtgaccaccaagcacgtgcggctcaaggccgtc
cacacctatgcggattccggcaacgacaagttcatgtccgcctccgaaatccgcctgcgc
aaggccgtcgacaccaccgacatcagcggcgcgaccgtgaccgtgcccgccaagctgacc
gtcgaccgggtggacgccgaccatcccgccaccttcgccacgaaggacgtgacggtgacg
ttgggcgacgccacgctgcgctacggcgtggactacctgctcgactacgcgggcaacacc
gccgtcggcaaggccacggtgaccgtgcgcggcatcgacaagtactccggcaccgtcgcc
aagacgttcaccatcgaactgaagaacgccccggcgccggaaccgacgctgacctcggtg
agcgtcaagaccaagccttccaagctgacctatgtggtcggcgacgcgttcgacccggca
ggactggtgctgcagctcaactatgacgacgacagcaccggcaccgtgacctggaacacg
cagacggccggcgacttcacgttcaagcctgcgctcgacgcgaagctcaaggtcaccgac
aagaccgtcaccgtcacctaccagggcaagtccgcggtcatcgacatcaccgtctcgcag
cccgccccgaccgtcagcaagacggatctggacaaggccatcaaggcgatcgaggccaag
aacccggattcgtccaagtacacggccgactcgtggaagaccttcgcggacgccatggcg
catgccaaggccatcatcgcggatgattccgccacccagcaggacgtcgataacgcgctc
aaggcgctgaccgacgcctacgccgggctgaccgagaagacgcccgaacccgcccccgtc
agcaagtccgagctggacaagaagatcaaggcgatcgaggccgagaagctggacgggtcg
aagtacacggccgagtcgtggaaggcgttcgagaccgccctggcgcatgccaaggccgtc
atcgccagcgattccgccacccagcaggatgtggacgcggcccttggcgccctgacctcc
gctcgcgacggactgaccgagaagggcgaggtcaagcccgacccgaagcccgaaccgggc
accgtcgacaaggcggcgctggataaggcggtcaagaaggtcgaggccgagaagctggac
gggtcgaagtacacggccgagtcgtggaaggcgttcgagaccgccctggcgcatgccaag
gccgtcatcggcaacgccaactccacgcagttcgacatcgacaacgcgctgtcgatgctc
aacgacgcccgcgccgcgctcaaggagaagcccggccgcatcatcgccatcatcgatggc
agcgcactgagcaagaccggcgcatccgtcgccagcatcgcctccgtcgcggccgcgatg
ctggcggtcggtgccggcgtcatggcgttgcgccgcaagcgcttctga

DBGET integrated database retrieval system