Bison bison bison (American bison): 104987029 Help Entry 104987029         CDS       T08726                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism bbis  Bison bison bison (American bison) Pathway bbis01523   Antifolate resistance bbis04010   MAPK signaling pathway bbis04014   Ras signaling pathway bbis04024   cAMP signaling pathway bbis04062   Chemokine signaling pathway bbis04064   NF-kappa B signaling pathway bbis04066   HIF-1 signaling pathway bbis04071   Sphingolipid signaling pathway bbis04137   Mitophagy - animal bbis04151   PI3K-Akt signaling pathway bbis04210   Apoptosis bbis04211   Longevity regulating pathway bbis04218   Cellular senescence bbis04380   Osteoclast differentiation bbis04613   Neutrophil extracellular trap formation bbis04620   Toll-like receptor signaling pathway bbis04621   NOD-like receptor signaling pathway bbis04622   RIG-I-like receptor signaling pathway bbis04623   Cytosolic DNA-sensing pathway bbis04625   C-type lectin receptor signaling pathway bbis04657   IL-17 signaling pathway bbis04658   Th1 and Th2 cell differentiation bbis04659   Th17 cell differentiation bbis04660   T cell receptor signaling pathway bbis04662   B cell receptor signaling pathway bbis04668   TNF signaling pathway bbis04722   Neurotrophin signaling pathway bbis04917   Prolactin signaling pathway bbis04920   Adipocytokine signaling pathway bbis04926   Relaxin signaling pathway bbis04931   Insulin resistance bbis04932   Non-alcoholic fatty liver disease bbis04933   AGE-RAGE signaling pathway in diabetic complications bbis04936   Alcoholic liver disease bbis05010   Alzheimer disease bbis05022   Pathways of neurodegeneration - multiple diseases bbis05030   Cocaine addiction bbis05132   Salmonella infection bbis05133   Pertussis bbis05134   Legionellosis bbis05135   Yersinia infection bbis05140   Leishmaniasis bbis05142   Chagas disease bbis05145   Toxoplasmosis bbis05146   Amoebiasis bbis05152   Tuberculosis bbis05160   Hepatitis C bbis05161   Hepatitis B bbis05162   Measles bbis05163   Human cytomegalovirus infection bbis05164   Influenza A bbis05165   Human papillomavirus infection bbis05166   Human T-cell leukemia virus 1 infection bbis05167   Kaposi sarcoma-associated herpesvirus infection bbis05168   Herpes simplex virus 1 infection bbis05169   Epstein-Barr virus infection bbis05170   Human immunodeficiency virus 1 infection bbis05171   Coronavirus disease - COVID-19 bbis05200   Pathways in cancer bbis05202   Transcriptional misregulation in cancer bbis05203   Viral carcinogenesis bbis05207   Chemical carcinogenesis - receptor activation bbis05208   Chemical carcinogenesis - reactive oxygen species bbis05212   Pancreatic cancer bbis05215   Prostate cancer bbis05220   Chronic myeloid leukemia bbis05221   Acute myeloid leukemia bbis05222   Small cell lung cancer bbis05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bbis05321   Inflammatory bowel disease bbis05415   Diabetic cardiomyopathy bbis05417   Lipid and atherosclerosis bbis05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104987029 (RELA)    04014 Ras signaling pathway     104987029 (RELA)    04064 NF-kappa B signaling pathway     104987029 (RELA)    04668 TNF signaling pathway     104987029 (RELA)    04066 HIF-1 signaling pathway     104987029 (RELA)    04071 Sphingolipid signaling pathway     104987029 (RELA)    04024 cAMP signaling pathway     104987029 (RELA)    04151 PI3K-Akt signaling pathway     104987029 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     104987029 (RELA)   09143 Cell growth and death    04210 Apoptosis     104987029 (RELA)    04218 Cellular senescence     104987029 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104987029 (RELA)    04620 Toll-like receptor signaling pathway     104987029 (RELA)    04621 NOD-like receptor signaling pathway     104987029 (RELA)    04622 RIG-I-like receptor signaling pathway     104987029 (RELA)    04623 Cytosolic DNA-sensing pathway     104987029 (RELA)    04625 C-type lectin receptor signaling pathway     104987029 (RELA)    04660 T cell receptor signaling pathway     104987029 (RELA)    04658 Th1 and Th2 cell differentiation     104987029 (RELA)    04659 Th17 cell differentiation     104987029 (RELA)    04657 IL-17 signaling pathway     104987029 (RELA)    04662 B cell receptor signaling pathway     104987029 (RELA)    04062 Chemokine signaling pathway     104987029 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     104987029 (RELA)    04917 Prolactin signaling pathway     104987029 (RELA)    04926 Relaxin signaling pathway     104987029 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     104987029 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     104987029 (RELA)   09149 Aging    04211 Longevity regulating pathway     104987029 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     104987029 (RELA)    05202 Transcriptional misregulation in cancer     104987029 (RELA)    05207 Chemical carcinogenesis - receptor activation     104987029 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     104987029 (RELA)    05203 Viral carcinogenesis     104987029 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     104987029 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     104987029 (RELA)    05221 Acute myeloid leukemia     104987029 (RELA)    05220 Chronic myeloid leukemia     104987029 (RELA)    05215 Prostate cancer     104987029 (RELA)    05222 Small cell lung cancer     104987029 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     104987029 (RELA)    05170 Human immunodeficiency virus 1 infection     104987029 (RELA)    05161 Hepatitis B     104987029 (RELA)    05160 Hepatitis C     104987029 (RELA)    05171 Coronavirus disease - COVID-19     104987029 (RELA)    05164 Influenza A     104987029 (RELA)    05162 Measles     104987029 (RELA)    05168 Herpes simplex virus 1 infection     104987029 (RELA)    05163 Human cytomegalovirus infection     104987029 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     104987029 (RELA)    05169 Epstein-Barr virus infection     104987029 (RELA)    05165 Human papillomavirus infection     104987029 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     104987029 (RELA)    05135 Yersinia infection     104987029 (RELA)    05133 Pertussis     104987029 (RELA)    05134 Legionellosis     104987029 (RELA)    05152 Tuberculosis     104987029 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     104987029 (RELA)    05145 Toxoplasmosis     104987029 (RELA)    05140 Leishmaniasis     104987029 (RELA)    05142 Chagas disease     104987029 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     104987029 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     104987029 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     104987029 (RELA)   09165 Substance dependence    05030 Cocaine addiction     104987029 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     104987029 (RELA)    05418 Fluid shear stress and atherosclerosis     104987029 (RELA)    05415 Diabetic cardiomyopathy     104987029 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     104987029 (RELA)    04932 Non-alcoholic fatty liver disease     104987029 (RELA)    04931 Insulin resistance     104987029 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     104987029 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     104987029 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bbis03000]     104987029 (RELA) Transcription factors [BR:bbis03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     104987029 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  104987029 NCBI-ProteinID:  XP_010836092 Ensembl:  ENSBBBG00000024071 UniProt:  A0A6P3H9V8 LinkDB All DBs Position Unknown AA seq 562 aa AA seqDB search MWAPADPCLPLLSDLFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGE RSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRC IHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPA GRPLRLAPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFT GPGWEARGSFSQADVHRQVAIVFRTPPYADPGLQAPVRVSMQLRRPSDRELSEPMEFQYL PDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTDPRPPTRRIAVPNRGSASIPKPAPQPY SFTPSLSTINFEEFSPMVFPSGQIPSQTSALAPAPTPVLTQTQVLAPAPAPAPGMASTLA QALAPGLAQAVTPPAPRTNQTGEGTLTEALLQLQFDTDEDLGALLGNNTDPAVFTDLASV DNSEFQQLLNQGVPMGPHTTEPMLMEYPEAITRLVTGSQRPPDPAPTPLGPPGLTNGLLS GDEDFSSIADVDFSALLSQISS NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt atgtgggctcctgctgacccttgtctccctctcctttcagacctcttccccctcatcttc cctgcagagccggcgcaggcctctggcccctatgtggagatcatcgagcagcccaagcag cggggcatgcgcttccgctacaagtgtgagggccgctcagctggcagcatccctggagag aggagcacggacaccaccaagacccaccccactatcaagatcaatggctacacggggcca gggacagtccgcatctccctggtcaccaaggacccccctcaccggcctcacccccacgag ctagtggggaaagactgccgggatggcttctatgaggctgagctctgcccggaccgctgc atccacagctttcagaacctggggatccagtgtgtaaagaagcgggacctggagcaggcc atcagccagcgcatccagaccaacaacaaccccttccaagttcccatagaagagcagcgc ggggactacgacctgaatgccgtccggctctgcttccaggtgacagtgcgggacccggca ggcaggcccctccgcctggcgcctgtcctctctcaccccatctttgacaaccgcgccccc aacaccgccgagctcaagatctgccgggtgaatcggaactctgggagctgccttggcggg gatgagatcttcctgctgtgtgacaaggtgcagaaagaggacatcgaggtgtatttcacg ggaccaggctgggaggcccgaggctctttttcacaagctgacgtgcaccggcaagtggcc atcgtgttccggacgccgccctacgcggaccccggcctgcaggcccctgtgcgcgtctcc atgcagctgcggcggccttccgatcgggagctcagtgagcccatggaattccagtacttg ccagacacagacgatcgtcaccggattgaggagaagcgcaaaaggacgtacgagaccttc aagagcatcatgaaaaagagccctttcaatggacccaccgacccccggcctccaacccgg cgcatcgctgtgcctaaccgcggctcagcctccatccccaagccagctccccagccctat tcctttacgccatctctcagcaccatcaactttgaggagttttcccccatggtctttcct tctgggcagatcccaagccagacctcggccttggcaccagcccccaccccggtcctgacc cagacccaagtcctggccccagccccggccccagccccaggcatggcatcaaccctggcc caggccctagccccaggcctggctcaggctgtgaccccgcctgcccccaggaccaaccag acgggggaagggacactgacagaggccctgctgcagctgcagtttgataccgatgaagac ctgggggctctgcttggcaacaacactgaccctgccgtgttcacagacctggcatctgtc gacaactctgagtttcagcagttgctgaaccagggtgtacccatgggcccccacacaact gagcccatgctgatggagtaccctgaggctataactcgcctggtgacagggtcccaaagg ccccctgacccagctcccactcccctggggccccctgggctcaccaatggcctcctctcg ggggatgaagacttctcctccatcgcggatgtggacttctcagcccttctgagtcagatc agctcctaa

DBGET integrated database retrieval system