KEGG   Bordetella bronchialis: BAU06_21295Help
Entry
BAU06_21295       CDS       T04591                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bbro  Bordetella bronchialis
Brite
Enzymes [BR:bbro01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BAU06_21295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
4837226..4837768
Genome map
AA seq 180 aa AA seqDB search
MYPTHTRKILAAAAALGAALCAATPVQADVTVPMALATPTGKGQDIGTVTLSQNKYGLVL
TPDLKGLPPGLHGFHVHDKGDCGPSQQDGKPVPAGAAGGHYDPNQTKKHGTPWGDGHRGD
LPALYVDSNGNATNPVLAPRLKLSEVHHHALMVHAGGDNHSDHPMPLGGGGGRVACGVIP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtatcccacccacacccgcaagatcctggccgccgcggcggcccttggcgccgcgctg
tgcgccgccacgccggtccaggccgacgtcaccgtgccgatggcgctggccacgcccacc
ggcaagggccaggacatcggcacggtcacgctgtcgcagaacaagtatggcctggtgctg
acgcccgacctgaaaggcttgccaccgggcctgcacggcttccacgtccacgacaaaggc
gattgcgggccctcgcagcaggacggcaagcccgtgcccgccggcgcggcgggcgggcac
tacgatcccaaccagaccaagaagcatggcacgccctggggcgacggccaccgcggcgac
ttgccggccctgtacgtggacagcaacggcaacgccaccaatcccgtcctggcgccccgc
ctgaagctatccgaggtccatcatcacgccctgatggtccacgccggcggcgacaatcac
agcgaccatcccatgccgctgggcggcggcggcggccgcgtcgcctgcggcgtcatcccg
taa

DBGET integrated database retrieval system