KEGG   Bifidobacterium breve UCC2003: Bbr_0052Help
Entry
Bbr_0052          CDS       T02534                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bbru  Bifidobacterium breve UCC2003
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbru00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bbr_0052 (ppc)
  Energy metabolism
   00680 Methane metabolism
    Bbr_0052 (ppc)
Enzymes [BR:bbru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Bbr_0052 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(73711..76464)
Genome map
AA seq 917 aa AA seqDB search
MATPEEQITPADAAIVTTGTGRKGPEEHDLPQSLKDDMDLCLKILRDVLGEYNPELLSTF
DTVRNYSVEASAEHFAELEDPNPAQDGLKEAVNVIDNMTLHDAQLLARAFATYFHLANLS
EENYRVSVLHERENNVSGEQAVDPINELTVAYHQLINEMGPAKAKELLDQLEFHPVFTAH
PTEARRKAVEGKIRRISELLGEYKILGGSDKKECLRRLYNEIDALFRTSPIALKKPTPVE
EADTILDIFDNTLFHTIPKVYRRFDDWILGDQAGLVEPVCPAFFHPGSWIGSDRDGNPNV
TAKVSRAVARKFSDHVIAALEEATRTVGRNLTMEAETTPPSAELKNLWSHQKEMSERLTD
KAALISTKEMHRAVMLVMADRLHYTIERDADLMYHSCDDFLNDLKVVQRSLAEAGAKRSA
YGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALADIREHGLHGERGDLQPMTHEVLDTF
RALGAIQKRNGLKAARRYIISFTKSAQNIKDVYELNRLAFSHPEDVPTIDVIPLFEQLED
LQNSVDVLEEMIKIPEVQARLKATGNKLEVMLGYSDSSKDAGPTSATLALHSAQERIAKW
AESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPVLA
IRHVESVAAATLLQSAPSVEKRNTDMTKKYADMAAQLDEAAHNRFLDLLNTDGFAPWFSI
VTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEKFGD
LETMRQAYEEWPLFSTFIDNIEMSIAKTDERIAKMYLALGDREDLNKKVLEEMELTRKWV
LDIVGDKWPLQHRHVLGQAIRIRSPYVDALSVTQVLALKSLRKKVDKEELSQSQQAGFIY
LILCTVSGVAAGLQNTG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaccagaagaacagatcactcctgctgacgccgccatcgtcaccaccggaact
ggccgcaagggccccgaggagcatgatctcccccaaagcctcaaggacgacatggatctg
tgtttgaagatcctgcgtgacgtactgggcgaatacaaccccgaactgctctccacgttc
gacaccgtgcgtaattactcggtggaagccagcgctgaacacttcgccgagttggaggat
ccgaaccccgcacaggatggcctgaaagaggccgtgaacgtcatcgacaacatgacgcta
cacgatgcccagctgctggcccgcgcattcgccacgtacttccatctggcaaacctgtcc
gaggagaactaccgcgtttccgtgctccatgagcgcgagaacaacgtatccggcgagcag
gcggtcgatccgatcaacgagctcaccgtcgcctaccaccagctcatcaacgagatgggc
ccggccaaggccaaggagctgctcgaccagcttgagttccaccccgtcttcaccgcgcac
cccactgaagcacgccgcaaggcagtggaaggcaagatccgccgcatctccgaattgctc
ggggaatacaagattctcggcggctcggacaagaaggaatgcctgcgccgtctctataac
gagatcgacgccctgttccgcacctctccaatcgcgctgaagaagccgaccccggttgag
gaagcggacacgattctcgacatcttcgacaacacgctgttccacaccatccccaaggtc
taccgtcgcttcgacgactggattctgggcgaccaggccgggctcgtcgaacctgtctgc
cccgcgttcttccacccgggcagctggattggctccgaccgtgacggtaacccgaacgtc
accgccaaggtgagccgcgctgtggcccgcaagttctccgatcacgtgatcgccgctctc
gaggaagccacccgtacagtgggccgcaacctcacgatggaggccgagaccacgccgccg
agcgccgagctcaagaacctgtggagccaccagaaggaaatgagcgaacgcctgaccgac
aaggccgccctgatctccaccaaggagatgcaccgcgcggtcatgctggtgatggccgat
cgtctgcattacaccattgagcgcgatgccgacctcatgtaccactcctgcgacgacttc
ctcaacgatctcaaggtggtgcagcgttcgctggccgaggctggcgccaagcgctccgct
tacggcccgctgcaggatctgatttggcagaccgagaccttcggcttccacatggtggag
atggagttccgtcagcactctgtggtgcacgcccgcgcccttgcggacatccgcgaacat
ggtctgcacggcgaacgcggcgatctgcagccgatgacccacgaggtgctcgacaccttc
cgcgcgctcggggccatccagaagcgcaacggcctcaaggccgcccgccgctacatcatc
tccttcaccaagagcgcccagaacatcaaggatgtctacgagctcaaccgcttggcattc
tcccacccggaggatgtgcccaccatcgacgtaatcccgctgttcgagcagcttgaggat
ttgcagaactcggtggatgtgctcgaagaaatgattaagatccccgaggttcaggctcgc
ctgaaggccaccggcaacaagctcgaggtcatgctcggctactccgattcctcgaaggac
gccggaccgacctccgccacgctggcgctgcactccgcccaggaacgcatcgccaagtgg
gccgaatcgcacgacatcgacctgacgctgttccatggccgcggcggtgccgtcggtcgc
ggcggcggcccggccaaccgtgcggtgctcgcccagccggtcggttccgtcaagtgccgc
ttcaagctcaccgaacagggcgaggtcattttcgcccgttacggcaacccggtgcttgcc
atccgccacgtggagtccgtggctgcggcaaccctgctgcagtccgccccgagcgtggag
aagcgcaacaccgacatgaccaagaagtacgccgacatggctgctcagctcgacgaggcc
gcgcacaaccgcttcctcgacctgctgaacaccgatggcttcgccccgtggttctcgatc
gtcacgccgctgaccgaaatcggtctgctgccgattggctcccgcccggccaagcgcggc
cttggcgccaagtccctagacgatttgcgtacgattccgtggatcttctcctgggctcag
gcacgcatcaacctggccgcttggtacggcctcggtaccgcatgcgagaagttcggcgat
ctggagaccatgcgtcaggcctacgaggaatggccactgttctccacgttcatcgacaac
atcgagatgtccatcgccaagacggacgagcgcatcgccaagatgtacctcgccctcggc
gaccgcgaggacctcaacaagaaggtgctcgaggagatggagctcacccgcaagtgggtt
ctggacatcgtgggtgacaagtggccgctgcagcaccgccacgtgctcggccaggccatc
cgcattcgttcgccgtatgtggacgcgctgtccgtcacccaggtgctggcgctcaagtcg
ctgcgcaagaaggtggacaaggaagagctctcgcaaagccagcaggcaggattcatctat
ctgatcctctgcaccgtttcaggtgttgctgccggcctgcagaacacgggctga

DBGET integrated database retrieval system