KEGG   Bradyrhizobium sp. BTAi1: BBta_6512Help
Entry
BBta_6512         CDS       T00528                                 

Definition
(GenBank) Kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbt00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    BBta_6512
Enzymes [BR:bbt01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BBta_6512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
complement(6790918..6792111)
Genome map
AA seq 397 aa AA seqDB search
MTDFSYTRSLFKIPDGIIYLDGNSLGALPSAVPARVAAMIEAEWGQELIRGWNSAGWMVQ
PRRVGDRIARLIGAVPGTVVMGDTLSIKVYQALAAALSLNPSRRVILSDSGNFPSDLYMA
QGLVRMLGDRATLKVVDPEQVEAAIDDSVAVLMLTEVDYRTGRMHDMAALTQKAHAAGAL
TVWDLAHSAGAVPVDLAGADADFAVGCTYKYLNGGPGAPAFIYVAPRHADIAPPALSGWM
GHEAPFAFDLDYRPGGGIERMRIGTPPIIALAALDAALDAWDGVSMQDVRTASISLSELF
IAEVEARCPSLTLASPRDASRRGSQVSFRHPDGYAIMRALIARGVIGDFRAPDALRFGFT
PLYIGEAEVRGAVGILAEVLANRLWDKPEYRQKELVT
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacggatttttcctacacacgatcgcttttcaagatacctgacggcatcatctatctc
gacggcaattcgctgggagcgctgccgtccgcggtgcccgcgcgcgtcgccgccatgatc
gaggcggagtgggggcaggagctgatccgcggctggaacagcgccggctggatggtgcag
ccgcgccgcgtcggtgatcgcattgcccggctgattggcgctgtgcccggcacggtcgtg
atgggcgatacgctctcgatcaaggtgtatcaggcgctcgccgcggcgctctcgctcaat
ccgagccggcgcgtgatcctgtccgacagcggcaatttcccgtccgatctctacatggcg
caggggctggtccgcatgctcggcgaccgcgcgaccttgaaggtggtcgatcccgagcag
gtcgaggccgcgatcgacgacagcgttgccgtgctgatgctgaccgaggtggactaccgc
accggccggatgcacgacatggccgcgctgacgcagaaggcgcatgctgctggcgcgctc
acggtgtgggatctcgcgcattccgccggcgcggtgccggtggatcttgctggcgcggat
gcggacttcgccgtcggctgcacctacaaatatctcaatggcggtcccggcgcgccagcc
ttcatctatgttgcgccgcgccacgccgacatcgcgccgccggcgctgtcgggctggatg
ggccatgaggcgccgtttgccttcgacctggattatcgcccgggcggcggtatcgagcgc
atgcgcatcggcacgccgccgatcatcgcgctcgccgctctcgatgccgcgctcgacgcc
tgggacggcgtgtcgatgcaggacgtgcgcacggcctcgatctcgctctccgagctgttc
atcgccgaggtcgaggcgcgctgtccgtcgctgaccttggcgtcgccgcgcgatgcctcg
cggcgcggcagccaggtgtcgttccgtcatcccgacggctatgcgatcatgcgcgcgctg
atcgcgcgcggcgtcatcggcgacttccgcgcgcctgacgcgctgcgcttcggcttcacg
ccgctctatatcggcgaggccgaggtgcgcggcgccgtcggcatcctcgcggaggtcctc
gccaacaggctgtgggacaagcctgagtatcgccagaaggagctcgtgacgtga

DBGET integrated database retrieval system