Bubalus bubalis (water buffalo): 102397938 Help Entry 102397938         CDS       T05912                                  Symbol RELA Name (RefSeq) transcription factor P65   KO K04735   transcription factor p65 Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub01523   Antifolate resistance bbub04010   MAPK signaling pathway bbub04014   Ras signaling pathway bbub04024   cAMP signaling pathway bbub04062   Chemokine signaling pathway bbub04064   NF-kappa B signaling pathway bbub04066   HIF-1 signaling pathway bbub04071   Sphingolipid signaling pathway bbub04137   Mitophagy - animal bbub04151   PI3K-Akt signaling pathway bbub04210   Apoptosis bbub04211   Longevity regulating pathway bbub04218   Cellular senescence bbub04380   Osteoclast differentiation bbub04613   Neutrophil extracellular trap formation bbub04620   Toll-like receptor signaling pathway bbub04621   NOD-like receptor signaling pathway bbub04622   RIG-I-like receptor signaling pathway bbub04623   Cytosolic DNA-sensing pathway bbub04625   C-type lectin receptor signaling pathway bbub04657   IL-17 signaling pathway bbub04658   Th1 and Th2 cell differentiation bbub04659   Th17 cell differentiation bbub04660   T cell receptor signaling pathway bbub04662   B cell receptor signaling pathway bbub04668   TNF signaling pathway bbub04722   Neurotrophin signaling pathway bbub04917   Prolactin signaling pathway bbub04920   Adipocytokine signaling pathway bbub04926   Relaxin signaling pathway bbub04931   Insulin resistance bbub04932   Non-alcoholic fatty liver disease bbub04933   AGE-RAGE signaling pathway in diabetic complications bbub04936   Alcoholic liver disease bbub05010   Alzheimer disease bbub05022   Pathways of neurodegeneration - multiple diseases bbub05030   Cocaine addiction bbub05132   Salmonella infection bbub05133   Pertussis bbub05134   Legionellosis bbub05135   Yersinia infection bbub05140   Leishmaniasis bbub05142   Chagas disease bbub05145   Toxoplasmosis bbub05146   Amoebiasis bbub05152   Tuberculosis bbub05160   Hepatitis C bbub05161   Hepatitis B bbub05162   Measles bbub05163   Human cytomegalovirus infection bbub05164   Influenza A bbub05165   Human papillomavirus infection bbub05166   Human T-cell leukemia virus 1 infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05168   Herpes simplex virus 1 infection bbub05169   Epstein-Barr virus infection bbub05170   Human immunodeficiency virus 1 infection bbub05171   Coronavirus disease - COVID-19 bbub05200   Pathways in cancer bbub05202   Transcriptional misregulation in cancer bbub05203   Viral carcinogenesis bbub05207   Chemical carcinogenesis - receptor activation bbub05208   Chemical carcinogenesis - reactive oxygen species bbub05212   Pancreatic cancer bbub05215   Prostate cancer bbub05220   Chronic myeloid leukemia bbub05221   Acute myeloid leukemia bbub05222   Small cell lung cancer bbub05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bbub05321   Inflammatory bowel disease bbub05415   Diabetic cardiomyopathy bbub05417   Lipid and atherosclerosis bbub05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102397938 (RELA)    04014 Ras signaling pathway     102397938 (RELA)    04064 NF-kappa B signaling pathway     102397938 (RELA)    04668 TNF signaling pathway     102397938 (RELA)    04066 HIF-1 signaling pathway     102397938 (RELA)    04071 Sphingolipid signaling pathway     102397938 (RELA)    04024 cAMP signaling pathway     102397938 (RELA)    04151 PI3K-Akt signaling pathway     102397938 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102397938 (RELA)   09143 Cell growth and death    04210 Apoptosis     102397938 (RELA)    04218 Cellular senescence     102397938 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102397938 (RELA)    04620 Toll-like receptor signaling pathway     102397938 (RELA)    04621 NOD-like receptor signaling pathway     102397938 (RELA)    04622 RIG-I-like receptor signaling pathway     102397938 (RELA)    04623 Cytosolic DNA-sensing pathway     102397938 (RELA)    04625 C-type lectin receptor signaling pathway     102397938 (RELA)    04660 T cell receptor signaling pathway     102397938 (RELA)    04658 Th1 and Th2 cell differentiation     102397938 (RELA)    04659 Th17 cell differentiation     102397938 (RELA)    04657 IL-17 signaling pathway     102397938 (RELA)    04662 B cell receptor signaling pathway     102397938 (RELA)    04062 Chemokine signaling pathway     102397938 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     102397938 (RELA)    04917 Prolactin signaling pathway     102397938 (RELA)    04926 Relaxin signaling pathway     102397938 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102397938 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     102397938 (RELA)   09149 Aging    04211 Longevity regulating pathway     102397938 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102397938 (RELA)    05202 Transcriptional misregulation in cancer     102397938 (RELA)    05207 Chemical carcinogenesis - receptor activation     102397938 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     102397938 (RELA)    05203 Viral carcinogenesis     102397938 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102397938 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     102397938 (RELA)    05221 Acute myeloid leukemia     102397938 (RELA)    05220 Chronic myeloid leukemia     102397938 (RELA)    05215 Prostate cancer     102397938 (RELA)    05222 Small cell lung cancer     102397938 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102397938 (RELA)    05170 Human immunodeficiency virus 1 infection     102397938 (RELA)    05161 Hepatitis B     102397938 (RELA)    05160 Hepatitis C     102397938 (RELA)    05171 Coronavirus disease - COVID-19     102397938 (RELA)    05164 Influenza A     102397938 (RELA)    05162 Measles     102397938 (RELA)    05168 Herpes simplex virus 1 infection     102397938 (RELA)    05163 Human cytomegalovirus infection     102397938 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     102397938 (RELA)    05169 Epstein-Barr virus infection     102397938 (RELA)    05165 Human papillomavirus infection     102397938 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102397938 (RELA)    05135 Yersinia infection     102397938 (RELA)    05133 Pertussis     102397938 (RELA)    05134 Legionellosis     102397938 (RELA)    05152 Tuberculosis     102397938 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     102397938 (RELA)    05145 Toxoplasmosis     102397938 (RELA)    05140 Leishmaniasis     102397938 (RELA)    05142 Chagas disease     102397938 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     102397938 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     102397938 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     102397938 (RELA)   09165 Substance dependence    05030 Cocaine addiction     102397938 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102397938 (RELA)    05418 Fluid shear stress and atherosclerosis     102397938 (RELA)    05415 Diabetic cardiomyopathy     102397938 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102397938 (RELA)    04932 Non-alcoholic fatty liver disease     102397938 (RELA)    04931 Insulin resistance     102397938 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     102397938 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     102397938 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bbub03000]     102397938 (RELA) Transcription factors [BR:bbub03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     102397938 (RELA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  102397938 NCBI-ProteinID:  XP_006056522 EnsemblRapid:  ENSBBUG00015012683 LinkDB All DBs Position 5:complement(125323449..125332613) Genome browser AA seq 551 aa AA seqDB search MDDLFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLAPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPGLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPTRRIAVPNRGSASIPKPAPQPYSFTPSLSTINF EEFSPMVFSSGQIPSQTSALAPAPTPVLTQTQVLAPAPAPAPGMSSTLAQALAPGLAQAV TPPAPKTNQTGEGTLTEALLQLQFDTDEDLGALLGNNTDPAVFTDLASVDNSEFQQLLNQ GVPMGPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGPPGLTNGLLSGDEDFSSIADV DFSALLSQISS NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt atggacgacctcttccccctcatcttccccgcagagccggcgcaggcctctggcccctat gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggc cgctcagctggcagcatccctggagagaggagcacggacaccaccaagacccaccccact atcaagatcaatggctacacagggccagggacagtccgcatctccctggtcaccaaggac ccccctcaccggcctcacccccacgagctagtggggaaagactgccgggatggcttctat gaggctgagctctgcccggaccgctgcatccacagctttcagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagccagcgcatccagaccaacaacaacccc ttccaagttcccatagaagagcagcgcggggactacgacctgaatgctgtccggctctgc ttccaggtgacagtgcgggacccagcaggcaggcccctccgcctggcgcctgtcctctct caccccatctttgacaaccgcgcccccaacaccgccgagctcaagatctgccgggtgaat cggaactctgggagctgcctcggcggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacatcgaggtgtatttcacggggccaggctgggaggcccgaggctcgttttca caagctgacgtgcaccggcaagtggccatcgtgttccggacgccgccctacgcggacccc ggcctgcaggcccctgtgcgcgtctccatgcagctgcggcggccttccgatcgcgagctc agcgagcccatggaattccagtacttgccagacacagacgatcgtcaccggattgaggag aagcgcaaaaggacatacgagaccttcaagagcatcatgaaaaagagccctttcaatgga cccaccgacccccggcctccgacccggcgcatcgctgtgcctaaccgtggctcagcctcc atccccaagccagctccccagccctattcctttacgccatctctcagcaccatcaacttt gaggagttttcccccatggtcttttcttctgggcagatcccaagccagacctcggccttg gcaccagcccccaccccggtcctgacccagacccaagtcctggccccagccccggcccca gccccaggcatgtcatcaaccctggcccaggccctagccccaggcctggctcaggctgtg accccgcctgcccccaagaccaaccagaccggggaagggacactgacagaggccctgctg cagctgcagtttgataccgatgaagacctgggggctctgcttggcaacaacactgaccct gccgtgttcacagacctggcatctgtcgacaactctgagtttcagcagttgctgaaccag ggtgtacccatgggcccccacacagctgagcccatgctgatggagtaccctgaggctata actcgcctggtgacagggtcccaaaggccccctgacccagctcccactcccctggggccc cctgggctcaccaatggcctcctctcgggggatgaagacttctcctccatcgcagacgtg gacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system