KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0182Help
Entry
HMPREF9228_0182   CDS       T01844                                 

Definition
(GenBank) BNR/Asp-box repeat protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    HMPREF9228_0182
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HMPREF9228_0182
Enzymes [BR:bbv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     HMPREF9228_0182
Bacterial toxins [BR:bbv02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   HMPREF9228_0182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
223618..225909
Genome map
AA seq 763 aa AA seqDB search
MSHIPNQIHQTWNSALLPEQGGTLHAAFHVATDGMLLEARNAERVALAVTVSRGSLVVEA
PEDHIVLDVEDTYGVQFGGVHDLHITFGDFGTRIYLDGYQAFACATNICPSKYAQAGVFH
CANEAHIGVERLECFSEAWTSERIQGSVPVPQPDIEFAAAYLADKDVKTLHGVTDGTIYA
QFRVRGVGQFGTILAARDDDRQIMNVDIDDDGFVYRAFVKGQWCEYRAHGDWNDGGWHDL
VIRAFRGAVDIYVDGNMETHQPGQVFFGDLEGLSYVSIGEDTAGVRLCGEVRGGGLFLYP
LGEGQIRKISDVPPTTDTALFDKGYEGSASYRIPSLVTTPSGVTIAGADQRVVISNDAPN
EIHFVVRRSLDSGQTWLPLQTVIAFPGDGLDGASVIDSCIVCDRETGRVTVVIDHFPGGR
GFANVEKGLGLDARGRLILHDGEGAEYLLQPDGAVTSLDGEATSYRVDEDGNVTRDGESA
GNIYLKEGVDPHESLLAARTSYLVEVHSDDDGETWSKPRHINHMVKEGWMGFLGTSPGNG
IQLSAGKHRGRLLIPYYCTGTSPKFNAGGALISDDGGQAWRRGKAINEGRVVNGKVVDER
DVRDDDATTHESVFVERANGDVLCLFRNQHHLGRVGKAVSHDGGDTWETVEFDPDLPDIF
SQPNAVTVPSKAGEEPGCASDRIVFANASLMRPYRGCGVLRLSEDGGRTWARNRCFNPYH
YVYQCMSVLPDGAIGLSWERETAGVYFTHLPLSWFGVKSAAEE
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatattcccaatcaaatccaccagacatggaacagtgcgctgcttccggaacag
gggggaacgctgcatgcggcgttccacgtcgccacggacggcatgctgctggaagcgcga
aacgccgaacgcgtcgcgctggcggtcacggtttcccgcgggtcgctggtcgtcgaagcg
cccgaagaccatattgtgctggacgtcgaagacacctacggcgtgcagttcggcggtgtc
cacgaccttcatatcaccttcggcgattttggcacgcgaatctatctggatggctatcag
gccttcgcctgcgcgaccaacatttgcccgtcgaagtatgcgcaggctggcgtcttccac
tgcgccaatgaagcgcatatcggcgttgagcggctggaatgcttctcggaggcttggact
tcggagcgtattcagggcagcgttcccgtgccgcagccggatattgagtttgccgcggcc
tatttggcggacaaggatgtgaagacgctgcacggcgtgaccgacggcacgatctacgcg
cagttccgcgtacgtggcgtcggacagttcggcacgattcttgcggcgcgcgatgacgat
cgccagatcatgaacgtggacattgacgatgacggctttgtgtaccgcgctttcgtcaaa
ggacagtggtgtgagtatcgcgcccacggcgattggaacgatggcgggtggcatgatctg
gtcatccgcgcattccgcggtgcggtggacatctatgttgatggcaacatggaaacgcat
cagcccggtcaggtgttcttcggtgatctcgaggggctgagctacgtgtcgatcggcgag
gacacggccggtgtgcggttgtgcggcgaagttcgcggcggcggtctgttcctgtatcct
ctgggagaagggcagattcgcaaaatctccgacgtgccgcccaccaccgataccgcgttg
ttcgacaaaggatatgaaggatccgcaagctaccgcatcccgtctttggtgactacgccc
tccggtgtgacgattgccggtgccgaccaacgtgtggtcatctccaacgatgcccccaat
gagatccatttcgttgtccgccgctccttggatagcggacagacgtggctgccgctgcaa
accgtcatcgcctttcccggtgatgggctggatggcgcgagcgtcatcgactcatgcatc
gtctgtgatcgtgagacaggccgtgtgacggtcgtcattgaccattttccgggcggtcga
ggcttcgccaacgttgaaaagggcttggggttggatgcccgggggcggctcatcctgcac
gatggcgagggggcggaatacctgctccaacctgatggtgcggtaacgtccttggacgga
gaagccacgtcataccgtgtggatgaggatggcaacgtcacacgcgatggtgagtccgcg
ggcaacatctatctcaaggagggcgtcgacccgcatgaaagcctgctggccgcgcgtacc
agctatctggtggaagtgcattcggacgatgatggcgaaacatggtccaagcccaggcac
atcaaccatatggtcaaggaaggatggatgggttttctgggcacgtcgcccggcaacggc
atccagctgagcgccggcaaacatcgggggcgactgctcatcccgtactattgcaccggc
acgagccccaagttcaacgcaggcggcgcgctgatctccgatgatggtggccaggcgtgg
cgcagaggcaaagccatcaacgaggggcgcgtagtcaacggcaaggtcgtggacgaacgg
gacgtgcgcgatgacgatgccaccacgcacgaatcggtgttcgtggaacgggccaacggc
gatgtgctgtgcctgttccgcaatcaacatcatctgggcagggtcggcaaggccgttagc
catgatggtggtgatacatgggaaaccgttgagttcgatcccgatctgccggacatcttc
agccagcccaatgcggtgacggtcccgtccaaagccggcgaggagcccggctgcgcatcc
gaccggatcgttttcgccaatgccagcctgatgcgtccctaccgtggctgcggtgtgctg
cggctgagtgaggatggcggccgcacgtgggcgcgcaatcggtgcttcaatccctatcac
tatgtctaccagtgcatgtcggtgctgccggatggggccattggcctgtcttgggagcgg
gaaacggccggagtgtacttcacgcatctgccgctgagctggttcggagtgaagtcggct
gcggaggagtga

DBGET integrated database retrieval system