KEGG   Bacillus cereus ATCC 10987: BCE_5457Help
Entry
BCE_5457          CDS       T00162                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bca  Bacillus cereus ATCC 10987
Pathway
bca00240  Pyrimidine metabolism
bca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bca00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BCE_5457 (tdk)
Enzymes [BR:bca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BCE_5457 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 UvrD-helicase zf-C4_ClpX
Motif
Other DBs
NCBI-ProteinID: AAS44357
UniProt: Q72XC1
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(5037257..5037844)
Genome map
AA seq 195 aa AA seqDB search
MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNG
LKVKAVPVSASKDIFEHITEEMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDF
RGLPFGQVPQLMAIAEHVTKLQAVCSACGSPASRTQRLIDGEPAAFDDPIILVGASESYE
PRCRHXHAVPTNKDK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtacttaataaatcagaacggttggattgaagtgatttgcggtagtatgttttctggt
aaatcagaagagcttatccgccgtgtgcgtcgtacgcaatttgcgaaacaacatgcaatt
gtatttaaaccatgtattgataatcgctatagtgaagaagacgttgtatcacataacgga
ttaaaggtaaaagcagttcctgtttcagcttcaaaagatatatttgaacatatcactgaa
gaaatggatgtaattgcaatcgatgaggtgcaattctttgatggggacattgtggaagtg
gtgcaagtattggcaaatcgtggctatcgtgtcattgtagctggtttagaccaagatttc
cgtggtctaccatttggacaagttcctcagctgatggcgattgctgaacatgtaacaaaa
ctacaagcagtatgttctgcatgtggatctccggcaagtcgtacacaacgattaattgat
ggagaaccagcggcatttgatgatccgattattttagttggtgcttcagaatcgtatgaa
ccacgctgtcgtcatkgtcatgcagttcctacaaacaaagataagtaa

DBGET integrated database retrieval system