KEGG   Paraburkholderia caribensis: K788_0007702Help
Entry
K788_0007702      CDS       T04141                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
bcai  Paraburkholderia caribensis
Brite
Translation factors [BR:bcai03012]
 Eukaryotic Type
  Elongation factors
   K788_0007702
 Prokaryotic Type
   K788_0007702
Mitochondrial biogenesis [BR:bcai03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    K788_0007702
Exosome [BR:bcai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   K788_0007702
  Exosomal proteins of breast cancer cells
   K788_0007702
  Exosomal proteins of colorectal cancer cells
   K788_0007702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:1074845..1076035
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTAKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaggtaagtttgagcggaccaagccgcacgtgaacgtcggcacgatcggtcac
gttgaccacggcaagaccacgctgacggcagcgatcacgacggtgctgaccgcgaagttc
ggcggcgaagcaaaggcctacgaccagatcgacgcagcgccggaagaaaaggcgcgcggt
atcacgatcaacacggcacacgtcgagtacgaaacggcgaaccgccactatgcgcacgtc
gactgcccgggccacgctgactatgtgaagaacatgatcacgggcgcagcgcagatggac
ggcgcaatcctggtgtgctcggctgctgacggtccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggtcggtgtgccgtacatcatcgtgttcctgaacaagtgcgacatg
gtcgacgacgccgagctgctggagctggtcgaaatggaagtgcgcgaacttctgtcgaag
tacgacttcccgggcgacgacacgccgatcatcaagggttcggcgaagctggcgctcgaa
ggcgacaagggcgagctgggcgaagtggcgatcatgaacctggccgacgcactggacacg
tacatcccgacgccggagcgcgcggttgacggcgcgttcctgatgccggtggaagacgtg
ttctcgatctcgggtcgcggcacggtggtgacgggtcgcgtcgagcgcggcatcgtcaag
gtcggcgaagaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacgggc
gtggaaatgttccgcaagctgctcgaccaaggtcaggcaggcgacaacgttggtatcctg
ttgcgcggcacgaagcgtgaagacgtggagcgtggccaggtgctggccaagccgggttcg
atcacgccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggatgaaggcggc
cgtcacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgatcgctccgatcgccatggaagaaggtctgcgcttcgcaatccgt
gaaggtggccgtaccgtcggcgcaggtgtcgttgcaaagatcatcgagtaa

DBGET integrated database retrieval system