KEGG   Paraburkholderia caribensis: K788_0007984Help
Entry
K788_0007984      CDS       T04141                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bcai  Paraburkholderia caribensis
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bcai00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    K788_0007984
Enzymes [BR:bcai01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     K788_0007984
DNA repair and recombination proteins [BR:bcai03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     K788_0007984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:2487695..2490580
Genome map
AA seq 961 aa AA seqDB search
MADKLDTYQRKRRFDKTPEPSGTAARAKGAKGAKGAKDANTAARSTAKPHSLSFVIQEHD
ARRLHYDFRLELDGTLKSWAVPKGPSLDPSVKRLAVHVEDHPLEYGSFEGSIPEGNYGAG
SVIVWDRGTWEPTGGEAGARDAYQAGKLKFHLNGEKLHGGWTLVRSHMRGSGDKEQWLLI
KERDDDARSEADFDVLDERQGSVLSDAPGARGGTSGKSVSSKPVADKPKSQAERVNASIK
ATKAAASRKAKGTPADRPDIVATRNAASLRELAGHPSIEGAVEAKLPAALKPQLATLVDN
APTGDDWVYEIKFDGYRVLVRIDHASKDSVKIFTRAGNDWTTKFSKQVKAIARIGVDCAW
LDGEAVVLDSNGVPSFQALQNAFDAHRPQDITLYLFDLPYLNGYDLRGVPLEQRRAILHA
LLDSVDDDTLRFSEDFGFDAGQLLKSACDMQLEGIIGKRRDSHYVSGRSPAWIKLKCRRR
QEFVIGGYSEPAGSREAFGALLLGVYDTKGKLQYAGRVGTGFDAARLRSIKKALDARETQ
TMPFASEPRERSRTPVHWVKPELVAECNFAEWTSDGIVRQASFVGLRDDKPARQIVHEAP
DKGADVQQMTEEMNAAQAKTSTAKKRASKTEDVEPTPATNRAKTSGAASRDKVVAKSTSK
AATATVSGVRISHPDRVIDKSTGARKIELAEYYASVASWMLPFLKDRPVALVRAPEDIGG
ELFFQKHSQKLAIPNITQHPGLDPDHPPLLTIESEAALVGAAQMGTIELHTWNAVAANIE
KPDRMVFDLDPGPALGWKRMIEAAQLTRELLEELGLASFCKTSGGKGLHVVVPIAKQLGW
DEVKAFTQAVAQHMATALPKHFAAKMGAQNRKGKIFVDYLRNNRGSSTVCAYSLRARPGL
GVSVPLTWDEVPGTTAGDQWNIANLHERLDALKSDPWADYAKTKQRITAAMRRRLDMAEH
D
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaagctcgatacctatcagcgcaagcgccgcttcgataaaaccccggagccg
tcggggacggctgcgcgcgcgaagggtgcaaagggtgcaaagggtgcaaaggatgcaaac
acagccgcaagaagcaccgcgaagccgcacagcttgtcgttcgtaatccaggaacacgac
gcgcgacgtctgcattacgacttccgtctcgaactcgacggcacgctcaaatcctgggcc
gtgccgaaagggccgagcctcgatccgtccgtcaagcggcttgccgtgcatgtcgaagat
catccgctcgaatacggttcgttcgaaggttcgattcccgaaggcaactacggcgcgggc
tccgtgatcgtatgggatcgcggcacgtgggaaccgacgggcggcgaagcgggcgcacgt
gacgcgtatcaggcaggcaagctcaagttccacctgaatggcgagaagctgcacggcggc
tggacgctggtgcgcagccacatgcgcggcagcggcgacaaggagcagtggctgctcatc
aaggaacgcgacgacgacgcgcgcagcgaagccgatttcgacgtgctcgacgagcggcag
ggcagcgtgctgtcggatgcgccgggcgcgcgcggcggcacgagcggcaaaagcgtctcc
agcaagcccgtcgctgacaagccgaagagtcaagcggaacgcgtcaacgcatcgatcaag
gcaacgaaggcggcggcatcgcgcaaggccaaaggcactcccgccgaccgccccgacatc
gtcgcgacgcgcaacgcggcatcgttgcgcgaactggccggtcatccgtcgatagaaggc
gccgtcgaggcgaagctccccgctgcgctcaagcctcaactggcgacgctcgtcgacaac
gcgcccaccggcgacgattgggtctacgagatcaagttcgacggttatcgcgtgctggtg
cgcatcgatcacgcgtcgaaggattccgtgaaaatcttcacgcgcgcaggcaacgactgg
accacgaagttcagcaagcaggtcaaggcgatcgcgcgcatcggcgtggactgcgcgtgg
ctcgacggcgaggcggtcgtgctcgacagcaacggcgtgccgagcttccaggcgctgcaa
aacgccttcgacgcgcaccggccgcaggacatcaccttgtatctgttcgacctgccctat
ctgaacggctatgacctgcgcggcgtgccgctcgaacagcgtcgcgcgatcctgcacgcg
ctgctcgatagcgtcgatgacgacacgctgcgcttttccgaagacttcggcttcgacgcc
ggccagttgctgaagagcgcatgcgatatgcagctcgaaggcatcatcggcaagcggcgc
gacagccattacgtatcgggccgctcgcccgcgtggatcaaactcaagtgccggcgccgt
caggaattcgtgatcggcggttattcggaaccggcgggcagccgcgaggcattcggcgcg
ctgctgctgggcgtctacgacacgaagggcaagttgcaatacgcggggcgcgtcggcacg
ggtttcgacgcggccagactgcgctcgatcaagaaggcactcgacgcacgcgaaacacag
acgatgcccttcgccagcgagccgcgcgaacgaagccgcacgcctgtgcattgggtgaag
ccggaactcgtcgccgaatgcaattttgcggaatggacgagtgacggcatcgtgcggcag
gcgtcgtttgtcggcttgcgcgacgacaagcccgccaggcagatcgtccacgaagcgcca
gacaaaggagccgacgtgcaacagatgacggaagagatgaacgccgctcaggcgaagacg
tcgacggcgaaaaagcgcgcgtcgaagaccgaggatgtcgagccgacgcccgcgacaaat
cgtgcgaagacgagcggcgcggcatcgcgagacaaggtggtggcgaaatcgaccagcaag
gccgccacggcgacggtttccggcgtgcgtatctcgcaccccgaccgcgtgatcgacaag
agcacgggcgcgcgcaagatcgagcttgccgaatactacgcgtcggtcgcgtcgtggatg
ctgccgtttctgaaggaccggccggtcgcgctcgtgcgtgcgccggaggatatcggcggc
gagctgttcttccagaagcacagccagaagctcgcaattcccaacatcacgcagcatccg
gggctcgacccggaccatccgccgctgctgaccatcgaaagcgaagcggcgctggtgggc
gctgcgcagatgggcacgatcgaactgcatacgtggaacgcggtggccgcgaatatcgag
aaacccgaccgcatggtgttcgatctcgacccgggcccggcgctcggctggaagcggatg
atcgaagcggcgcagctcacgcgcgaactgctcgaagaactcggcctcgcgtcgttttgc
aagacgagcggcggcaaggggctgcacgtcgtcgtgccgatcgcgaagcaactcggctgg
gacgaggtgaaggcgttcacgcaagccgtcgcgcaacacatggcgacggcgctgccgaag
cactttgccgcgaagatgggtgcgcagaatcgcaagggcaagatttttgtcgactatctg
cgcaacaaccgtggctcgagcaccgtctgcgcgtattcgctgcgcgcgcggccggggctg
ggcgtgtcggtgccgctcacatgggacgaagtgcccggtacgacggcgggcgatcaatgg
aatatcgcgaacctgcacgagcggctcgacgcgctgaaaagcgacccatgggccgactac
gcgaagacgaagcagcgcatcacggccgccatgcggcgcaggctggatatggcggagcac
gattga

DBGET integrated database retrieval system