KEGG   Bifidobacterium catenulatum: BBCT_0015Help
Entry
BBCT_0015         CDS       T03931                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bcat  Bifidobacterium catenulatum
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcat00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBCT_0015
  Energy metabolism
   00680 Methane metabolism
    BBCT_0015
Enzymes [BR:bcat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BBCT_0015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(18310..21066)
Genome map
AA seq 918 aa AA seqDB search
MTTENEQITPADAAIVSSGTGTKGPEERDLPASLKEEMDLCLQILREVLGEFDEKLLDKF
DEVREHALNASAKRFSGILTDTNPNQDDLQKVVDIIDKTDVHEAQLLARAFTTYFHLANL
CEENYRVSVLHSREAAVDDTQAVDPVNEMTCAYHQLINEMGPAKAKELLDKLEFHPVFTA
HPTEARRKAVEGKIRRISQLLATHKLLGGSDKKENSRRLFNEIDALFRTSPIALKKPTPV
EESETILDIFDNTLFYTIPQVYRRFDDWVLGDKAGLVPPVCPAFFHPGSWIGSDRDGNPN
VTAKVSRQVARKFSDHVLGALEIETRRVGKNLTMEAETTPPSAELKSLWNHQKEMSERLT
DKAALISTKELHRAVMLVMADRLKATIDRDADLMYHSCEDYIADLKVVQRSLAEANAKRS
AYGPLQDLIWQAETFGFHMVEMEFRQHSVVHSRALEDIREHGLHGERGELQPMTHEVLDT
FRALGSIQKRNGIKAARRYIISFTKSAQNIKDVYELNRLAFSHPKDVPTIDVIPLFEQLE
DLQNSVDVLEEMIKIPEVQARLKATGGKMEVMLGYSDSSKDAGPTSATLALHSAQERIAK
WAESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPAL
AIRHVESVAAATLLQSAPSVEKRNTDMTAKYADMASKLDEAAHNRFLDLLNTDGFAPWFS
TVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEQFG
DLNTLRQAYEEWPLFSTFIDNIEMSLAKTDERIAKMYLALGDREDLNKKVLDEMELTRKW
VLEIVGDKWPLQHRHVLGQAIRIRSPYVDALSATQVLALGSLRKRVDKEELTHGQKENYT
YLILCTVSGVAAGLQNTG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgaaaacgaacagatcacgcctgccgacgcagctatcgtctcgtccggcacc
ggcaccaaaggccccgaggagcgtgatcttcccgcttccctcaaagaggaaatggatctg
tgtttgcagattcttcgcgaggtgctcggcgaattcgatgaaaagctgctggacaagttc
gatgaagtgcgcgaacacgcactgaacgctagcgccaaacgcttctccggcattctgacg
gatacgaatccgaatcaggatgacctgcagaaggtcgtcgacatcatcgataaaacggat
gtgcatgaggcacaactgctggcccgcgctttcaccacctacttccatctggccaaccta
tgcgaggagaactaccgtgtctccgtgctgcacagccgtgaggccgccgtagatgacacc
caagccgtcgacccagtgaacgaaatgacctgtgcctaccaccagctcattaacgaaatg
ggtccggccaaagccaaggaactgctcgacaagctcgagttccatccggtgttcaccgcg
catccgactgaagcccgccgcaaagccgtggaaggcaaaatccgccgcatctcccagctg
ctcgcaacgcacaagctgcttggcggttcagacaagaaggaaaactcccgtcgactcttc
aacgagattgacgcgctgttccgcacctctccgatcgcactgaagaagccgactccggtt
gaggaatctgaaaccattctcgatattttcgacaatacgttgttctataccattccacag
gtctaccgtcgtttcgacgattgggtcctcggagacaaggccggcctcgtgccgccggta
tgcccggcgttcttccacccgggaagctggatcggctccgaccgtgacggcaacccgaac
gtcaccgccaaggtgagccgtcaggtggcccgcaagttcagcgaccacgtgctgggcgcg
ctggagatcgagacccgccgcgttggcaagaacctgacgatggaagctgagaccactccg
ccgagtgccgagctcaagtccctgtggaaccaccagaaggaaatgagcgagcgcctgacc
gacaaggccgcactgatctccaccaaggagctgcaccgtgccgtcatgctggtcatggcc
gatcgtctgaaggccaccatcgaccgcgatgctgatctcatgtaccactcctgcgaggat
tacatcgccgacctgaaggtcgtgcagcgctccctcgccgaagccaacgccaaacgttcc
gcctacggcccgctgcaggacctcatctggcaggcagagacctttggcttccatatggtc
gagatggagttccgccagcactccgtcgtgcattcccgagcgctggaggatatccgcgaa
catggtctgcacggtgagcgtggcgaactgcagccgatgacccacgaggtgctcgacacc
ttccgcgcccttggttccatccagaagcgcaacggcatcaaggctgcccgtcgttacatc
atctccttcaccaagagcgcccaaaacatcaaggacgtgtacgagctgaaccgtctggcg
ttctcccatcccaaggatgttccaaccatcgacgtgatcccgctgtttgaacagcttgag
gatctgcagaactcggtagacgtactcgaggaaatgatcaagattccggaggtccaggct
cgtctgaaggccaccggcggcaagatggaagtcatgctcggctactccgactcctcgaag
gacgccggcccgacctccgcaaccctggccctgcattccgcacaggaacgcatcgccaag
tgggcggaatcgcatgacatcgatctgaccctgttccatggccgcggcggcgccgtcggc
cgcggcggaggcccggctaaccgtgccgtgctcgcacagccggtcggctccgtgaagtgc
cgcttcaagctcaccgagcagggcgaggtcatcttcgcgcgctacggcaacccggcactg
gccatccgccacgtcgagtccgttgcggctgcaacgctgctgcagtccgctccgagcgtg
gagaagcgcaatacggacatgaccgccaagtacgccgacatggccagcaagctcgacgag
gccgcgcataaccgcttcctcgacctgctgaacaccgacggattcgcaccgtggttctcc
accgtcacgccgctgaccgaaatcggcctgctgccgatcggctcccgtccggccaaacgc
ggccttggagccaagtccctcgacgatctgcgtaccattccgtggatcttctcctgggcg
caggcacgcatcaatctggctgcatggtacggcctgggcaccgcgtgcgagcagttcggc
gatttgaacaccttgcgtcaagcgtatgaggaatggcctctgttctccacgttcatcgac
aacatcgaaatgtcgctggccaagactgacgagcgcatcgccaagatgtaccttgctctc
ggagaccgtgaggacctcaacaagaaggtcctcgacgagatggagctcactcgcaagtgg
gtgctcgaaatcgtaggcgacaagtggcctctgcagcaccgccacgtgctcggccaggcc
atccgcatccgctcgccgtacgtagatgcgctgtccgccacccaggtgctcgccctcggc
tcgctacgcaagcgcgtggacaaggaagagctcacgcacggacagaaggagaactacacc
tacctgatcctgtgcaccgtgtcgggtgtcgcagcaggcttgcagaacaccggctga

DBGET integrated database retrieval system