KEGG   Burkholderia cenocepacia H111: I35_2492Help
Entry
I35_2492          CDS       T03804                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bceo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    I35_2492
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    I35_2492
   00680 Methane metabolism
    I35_2492
Enzymes [BR:bceo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     I35_2492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:2692000..2695014
Genome map
AA seq 1004 aa AA seqDB search
MKSSGSARTARRNAALPSPDAPTGTLATAANGRAKTATKPKDPIHQTKPATKAAGAPARK
AVAPKAGTRTRDDKDGPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDD
SEAAQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTV
AYALDQLKTTGNASKRLLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQE
LTARERQYNEAMLRARVTALWQTRMLRDSRLTVGDEIENALSYYRATFLDELPALYGDIE
AALAEHGLSARVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVILEHYLEQVHKLG
AELSVSNLLVGANDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEGTVP
VRSAGRGAPPVRAIPYEDSEAFVADLKVLTASLDEHHGASLAAPRLAPLVRAAEVFGFHL
ASIDLRQSSDIHEAVVAELFARAGVEADYAALAEEDKLRVLLAALADPRPLRSPYLEYSA
LAQSELGVFEKAREVRTQFGARAVRNYIISHTETVSDLVEVLLLQKETGLLEGTLGVPGR
DAKNSLMVIPLFETIPDLRDASRIMRDYFALPGIDALIAHQGAEQEVMLGYSDSNKDGGF
LTSNWELYRAELALVDLFRERKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRL
TEQGEVIASKFSNPSIGRRNLETVVAATLEASLLPQSNAPAQLPAFEAAMQTLSDSAMAA
YRALVYETPGFTDYFFSSTPITEIAELNIGSRPASRKLQDPKQRKIEDLRAIPWGFSWGQ
CRLLLTGWYGFGSAVSAYLDGAPDAAERTKRVTLLKKMNKTWPFFSNLLSNMDMVLAKTD
LAVASRYAQLVSDRKLRKHVFERIVAEWERTSQALAEITGHEGRLATNPLLARSIKNRFP
YLDPLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgtacggcgcgccgcaatgctgccttgccctcccccgac
gccccgacgggcaccctcgccaccgccgcgaacggccgtgcgaaaacggcaacgaaaccg
aaagacccgatacatcagacaaaacccgcgacgaaagccgccggcgcccccgcccgcaag
gccgtcgcaccgaaggccggcacccgcacgcgcgacgacaaggacggcccgctgttcgag
gacatccgcttcctcggccgcctgctcggcgacgtcgtgcgcgaacaggaaggcgatacg
gtgttcgacgtggtcgagacgatccgccagaccgcggtcaagttccgccgcgaggacgac
agcgaagccgcgcagacgctcgagaagaagctgcgcaagctgacgccggagcagacggtg
agcgtcgtgcgcgcgttcagctatttctcgcatctcgcgaacatcgcggaagaccgccac
cacaaccgccgccgccgcatccacgcgctggccgggtccgcgccgcagcccggcacggtc
gcgtacgcgctcgaccagctgaaaaccaccggcaacgcgtcgaagcgcctgctgcagcgc
ttcttcgacgatgcgctgatcgtgccggtgctgaccgcgcacccgaccgaagtgcagcgc
aagagcatcctcgatgcgcagcacgacatcgcgcgcctgctcgcggagcgcgaccaggag
ctgaccgcgcgcgaacgccagtacaacgaagcgatgctgcgcgcgcgcgtgaccgcgctg
tggcagacgcggatgctgcgcgactcgcgcctgacggtcggcgacgagatcgagaacgcg
ctgtcgtactaccgcgcgacgttcctcgacgaactgcccgcgctgtacggcgacatcgag
gccgcgctcgccgagcatggcctgtcggcccgcgtgcccgcgttcttccagatgggcagc
tggatcggcggcgatcgcgacggcaacccgaacgtgaccgcggcgacgctcgacgaggcg
atcaaccgccaggccgcggtgatcctcgaacattatctggaacaggtgcacaagctgggc
gccgagctgtcggtgtcgaacctgctggtcggcgcgaacgacgcggtgaaggcgctcgcg
gccgcatcgcccgaccagtcgccgcaccgcgtcgacgaaccgtatcgccgcgcgctgatc
ggcatctacacgcggctcgccgcgagcgcgcgcgtacgtctcggcgaaggcacggtgccg
gtgcgcagcgcgggccgcggcgcgccgcccgtgcgtgcgattccatacgaggactccgaa
gcgttcgtcgccgatctcaaggtgctgaccgcgtcgctcgacgagcaccacggcgcgtcg
ctcgccgcgccgcgcctcgcgccgctcgtgcgcgcggccgaagtgttcggcttccatctc
gcgagcatcgacctgcgccagagttccgacatccacgaggcggtggtcgccgaactgttc
gcgcgcgccggcgtcgaggccgactatgcggcgctcgccgaggaagacaagctgcgcgtg
ctgctcgccgcgctcgccgatccgcgcccgctgcgctcgccgtacctcgaatactcggca
ctcgcgcagagcgagctgggcgtgttcgagaaggcgcgcgaggtccgcacgcagttcggt
gcgcgcgcggtgcgcaactacatcatttcgcatacggaaaccgtcagcgacctcgtcgag
gtgctgctgctgcagaaggagacgggcctgctcgaaggcacgctcggcgtgccgggccgc
gacgcgaagaacagcctgatggtgatcccgctgttcgagacgatccccgacctgcgcgac
gcgtcgcgcatcatgcgcgactacttcgcgctgccgggcatcgacgcgttgatcgcgcat
cagggcgccgaacaggaagtgatgctcggctactcggacagcaacaaggacggcggattc
ctcacgtcgaactgggagctgtatcgcgcggaactcgcgctcgtcgacctgttccgcgag
cgcaagatcacgctgcggctgttccatggccgcggcggcacggtcggccgcgggggcggc
ccgacctaccaggcgatcctgtcgcagccgccgggcaccgtgaacggccagatccgcctg
accgaacagggcgaggtgatcgcgagcaagttctcgaacccgtcgatcggccggcgcaac
ctcgagacggtcgtcgccgcgacgctcgaggcgtcgctgctgccgcagtcgaacgcaccg
gcgcagttgcccgcgttcgaggccgcgatgcagacgctgtccgactcggcgatggccgcg
taccgcgcgctcgtctatgaaaccccgggcttcaccgactacttcttctcgtcgacgccg
atcaccgagatcgccgagctgaacatcggcagccggccggcgtcgcgcaagctgcaggac
ccgaagcagcgcaagatcgaggatctgcgcgcgattccgtggggcttctcgtggggccag
tgccggctgctgctgaccggctggtacggcttcggcagcgcggtgagcgcgtatctcgac
ggcgcgccggacgccgccgaacgcacgaagcgcgtcacgctgctgaagaagatgaacaag
acctggccgttcttctcgaacctgctgtcgaacatggacatggtgctcgcgaagaccgat
ctcgcggtcgcgtcgcgttatgcgcaactcgtgtccgaccgcaagctgcgcaagcacgtg
ttcgaacggatcgtcgcggaatgggaacgcacgtcgcaggcgctcgcggaaatcaccggg
cacgaaggccgcctcgcgaccaacccgctgctcgcgcgctcgatcaagaaccgcttcccg
tatctcgatccgctgaatcacctgcaggtcgagctgatcaagcgtcaccgcgcgggcgac
acgaacgcgcggctgcgccgcgggattcacctgacgatcaacgggatcgcggccggcctg
cgcaacaccggctga

DBGET integrated database retrieval system