KEGG   Burkholderia cenocepacia H111: I35_2614Help
Entry
I35_2614          CDS       T03804                                 

Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bceo  Burkholderia cenocepacia H111
Brite
Enzymes [BR:bceo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     I35_2614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CDN61137
LinkDB All DBs
Position
1:complement(2824429..2825007)
Genome map
AA seq 192 aa AA seqDB search
MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS
SGGIFNNAAQIWNHTFFWNSLSPNGGGAPTGALGDAINAKWGSYDAFKEAFTKAAVGTFG
SGWAWLVKKADGSLDIVSTSNAATPLTTADKALLTIDVWEHAYYIDYRNARPKFVEAFWN
IVNWDFAAKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctcatacgctcccgccgctcccgtacgctgaagacgcactcgcgccgaccatctcg
aaagagacgatcgagtaccactacggcaagcaccatcaggcttatgtgacgaacctgaac
aatctgatcccgggcacggaattcgaaaacttgccgctggaagagatcgtgaagaagtcg
tcgggcggcatcttcaacaacgccgcgcaaatctggaaccacacgttcttctggaacagc
ctgtcgccgaacggcggcggcgcaccgacgggcgcgctgggcgacgcgatcaacgcgaag
tggggttcgtacgacgcattcaaggaagcgttcacgaaggccgcggtcggcacgttcggt
tcgggctgggcatggctcgtgaagaaggccgacggttcgctcgacatcgtgtcgacgagc
aacgccgccacgccgctgacgaccgccgacaaggcactgctgacgatcgacgtgtgggaa
cacgcgtactacatcgactaccgcaacgcccgtccgaagttcgtcgaggcgttctggaac
atcgtgaactgggacttcgcagcgaagaacttcgcgtaa

DBGET integrated database retrieval system