KEGG   Burkholderia cepacia ATCC 25416: APZ15_17425Help
Entry
APZ15_17425       CDS       T04772                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bcep00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    APZ15_17425
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    APZ15_17425
   00680 Methane metabolism
    APZ15_17425
Enzymes [BR:bcep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     APZ15_17425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:3768686..3771700
Genome map
AA seq 1004 aa AA seqDB search
MKSSGSARTARRNAALSSSDASTDTVATAANGRAKTATKPKDPIRQTKRTAKAAGPAART
AGATKAGTRTRDDKDGPLFDDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDD
SEAAQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSASQPGTV
AYALEQLKTTGNASKRLLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQE
LTSRERQYNESMLRARVTTLWQTRMLRDARLTVGDEIENALSYYRATFLDELPALYGDIE
AALAEHGLSARVPAFFQMGSWIGGDRDGNPNVTASTLDEAINRQAAVILEHYLEQVHKLG
AELSVSNLLVGANDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEGTVP
VRSAGRGAPPVRAIPYADSEAFVADLKVLTASLDEHHGTSLAAPRLAPLVRAAEVFGFHL
ASIDLRQSSDIHEAVVAELFARAGVEADYAALAEEDKLRVLLAALADPRPLRSPYLEYSA
LAQSELGVFEKARDVRAQFGPRAVRNYIISHTETVSDLVEVLLLQKETGLLEGALGVPGG
NARNSLMVIPLFETIPDLRDAARIMREYFALPGIDALIAHQGAEQEVMLGYSDSNKDGGF
LTSNWELYRAELALVDLFRDRKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRL
TEQGEVIASKFANPEIGRRNLETVVAATLEATLLPQNNAPAQLPAFEAAMQTLSDSAMAA
YRALVYETPGFTDYFFSSTPITEIAELNIGSRPASRKLQDPKQRKIEDLRAIPWGFSWGQ
CRLLLTGWYGFGSAVSAYLDGAQDETERTKRVALLKKMNKTWPFFSNLMSNMDMVLAKTD
LAVASRYAQLVADRKLRKHVFERIVAEWERTAQALAEITGHEGRLATNPLLARSIKNRFP
YLDPLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgtacggcgcgccgcaatgctgccctgtcctcctccgac
gcctcgacggacaccgtcgccaccgccgcgaacggccgtgcgaaaacggcaacgaaaccg
aaagacccgatacgtcagacaaaacgcacggcgaaagccgccggcccggccgcccgcacg
gccggggcgacgaaggctggcacccgcacgcgcgacgacaaggacggcccgctgttcgac
gacatccgctttctcggccgcctgctcggcgacgtcgtgcgcgagcaggaaggcgacacc
gtgttcgacgtcgtcgagacgatccgccagaccgccgtcaagttccgccgcgaggacgac
agcgaagccgcgcagacgctcgagaaaaagctgcgcaagctgacgccggagcagacggtg
agcgtcgtgcgcgcgttcagctatttctcgcacctcgcgaacatcgcggaagaccgccac
cacaaccgccgccgccgcatccacgcgctggccggctccgcgtcgcagcccggcaccgtc
gcgtacgcactcgagcagttgaaaacgaccggcaatgcgtcgaagcgactgctgcagcgc
ttcttcgacgatgcgctgatcgtgccggtgctgaccgcgcacccgaccgaagtgcagcgc
aagagcatcctcgacgcgcagcacgacatcgcacgcctgctcgccgagcgcgaccaggag
ctgaccagccgcgagcgccagtacaacgaatcgatgctgcgcgcacgcgtcaccacgctg
tggcagacccgcatgctgcgcgacgcgcgcctgacggtcggcgacgaaatcgagaacgcg
ctgtcgtactaccgcgcgacgttcctcgacgaactgcccgcgctgtacggcgacatcgag
gccgcgctcgccgagcacggcctgtccgcgcgcgtacccgcgttcttccagatgggcagc
tggatcggcggcgaccgcgacggcaacccgaacgtgaccgcgtcgacgctcgacgaagcg
atcaaccgccaggccgcggtgatcctcgagcactatctggaacaggtgcacaagctcggc
gccgaactgtccgtgtcgaacctgctcgtcggtgcgaacgacgccgtgaaggcgctcgcg
gccgcgtcgcccgaccagtcgccgcaccgcgtcgacgagccgtatcgtcgcgcgctgatc
ggcatctacacgcggctcgccgcaagcgcgcgcgtgcgtctcggcgaaggcacggtgccc
gtgcgcagcgcgggccgcggcgcgccgcccgtgcgcgcgatcccgtatgcggattccgaa
gcgttcgtcgccgacctgaaggtgctgaccgcatcgctcgacgaacaccacggcacgtcg
ctcgccgcgccgcgcctcgcgccgctcgtgcgcgcggccgaagtgttcggcttccatctc
gcgagcatcgacctgcgccagagctccgacatccacgaagccgtggtcgccgagctgttc
gcgcgcgcgggcgtcgaggccgactacgcggcgctcgccgaggaagacaagctgcgcgtg
ctgctcgccgcgctcgccgatccgcgtccgctgcgctcgccgtacctcgaatactccgcg
ctcgcccagagcgaactcggcgtgttcgagaaggcgcgcgacgtgcgcgcccaattcggc
ccgcgcgcggtacgcaactacatcatttcgcatacggaaaccgtcagcgacctcgtcgag
gtgctgctgctccagaaggaaacgggcctgctcgaaggcgcgctcggcgtgcccggcggc
aacgcccgcaacagcctgatggtgatcccgctgttcgagacgattcccgacctgcgcgac
gccgcgcgcatcatgcgcgaatacttcgcgctgccgggcatcgacgcgctgatcgcgcac
cagggcgccgagcaggaagtgatgctcggctattcggacagcaacaaggacggcggcttc
ctcacgtcgaactgggagctgtatcgcgcggaactcgcgctcgtcgacctgttccgcgac
cgcaagatcacgctgcggctgttccacggccgcggcggcacggtcggccgcggcggcggc
ccgacctaccaggcgatcctgtcgcagccgccgggcaccgtgaacggccagatccgcctg
accgaacagggcgaggtgatcgcgagcaagttcgcgaacccggagatcggccgccggaac
ctcgagacggtcgtcgccgcgacgctcgaggcaacgctcctgccgcagaacaacgcgccc
gcgcagctgccggcgttcgaggccgcgatgcagacgctgtccgattcggcgatggccgcg
taccgcgcgctcgtctacgaaaccccgggcttcaccgactatttcttctcgtcgacgccg
atcaccgagatcgccgagctgaacatcggcagccgcccggcctcgcgcaagctgcaggat
ccgaagcagcgcaagatcgaggacctgcgcgcgattccgtggggcttctcgtggggccag
tgccggctgctgctgacgggctggtacggcttcggcagcgcggtgagtgcatatctcgac
ggcgcgcaggatgaaaccgagcgcacgaagcgcgtcgcgctgctgaagaagatgaacaag
acctggccgttcttctcgaacctgatgtcgaacatggacatggtgctggcgaagaccgac
ctcgcggtcgcgtcgcgctacgcgcaactggtcgccgaccgcaagctgcgcaagcacgtg
ttcgagcggatcgtcgcggaatgggagcgcacagcgcaggcgctggcggaaatcaccggg
cacgaaggccgcctcgcgaccaacccgctgctcgcgcgatcgatcaagaaccgcttcccg
tatctcgatccgctgaatcacctgcaggtcgagctgatcaagcgccaccgcgcgggcgac
acgaacgcgcggctgcgccgcgggattcacctgacgatcaacgggatcgcggccggcctg
cgcaacacgggctga

DBGET integrated database retrieval system