KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_3193Help
Entry
DM40_3193         CDS       T03488                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcew00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DM40_3193 (gabT)
   00650 Butanoate metabolism
    DM40_3193 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DM40_3193 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DM40_3193 (gabT)
Enzymes [BR:bcew01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DM40_3193 (gabT)
Amino acid related enzymes [BR:bcew01007]
 Aminotransferase (transaminase)
  Class III
   DM40_3193 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:228286..229569
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAISDQLNSFTHTAYQIVPYASYVELAEKINARAPGDYPKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNALHGVTTA
DSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIADEV
QTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADLMDAAAPGGLGGTYAGN
PLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNSLQADVPQIADVRGPGAMIAVEFLK
PGTGEPDADFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALVILEEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtcggcgtg
atgtgcgatttctacgcagcccgcgccgagaacgcggagctgtgggatgtcgaaggccgc
cgcttcatcgatttcgccgcgggcatcgcggtgctgaacacgggccaccgccacccgaag
atcgtcaaggcgatctcggatcagctgaacagcttcacgcacaccgcttaccagatcgtc
ccgtacgcgtcgtacgtcgagctcgcggaaaagatcaacgcgcgcgcgccgggcgactac
ccgaagaagaccgcgttcttcacgaccggcgccgaagccgtcgaaaacgcgatcaagatc
gcacgcgcggcgaccggccgtccgggcgtcatcgcgttctcgggcggcttccacggccgc
acgatgatgggcatggcgctgaccggcaaggtcgcgccgtacaagctgaacttcggcccg
ttcccgggcgacgtgttccacgcaccgtatccgaatgcgctgcacggcgtgacgacggcc
gactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgtgtcgcc
gcgatcattttcgaaccggtccagggcgaaggcggcttcaacccggcgccggccgaattc
gtgcgcgcgctgcgcaagatctgtaacgagcatggcatcctgctgatcgccgacgaagtg
cagaccggcttcgcgcgcaccggcaagctgttcgcgatgcagcactacgacgtgctggcc
gacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtcgtcggc
cgtgcggacctgatggacgcggccgctcccggcggcctcggcggcacctacgcgggcaac
ccgctggcggtggcgtcggcgcacgcggtgctcgagatcatcgacgaagagaagctgtgc
gagcgcgcgacgcaactcggcgacgtgctgaaggcgaagctgaactcgctgcaggcggac
gtgccgcagatcgccgacgtgcgcggtccgggcgcgatgatcgcggtcgaattcctgaag
ccgggcacgggcgagccggacgccgacttcacgaagcgcgtgcaggcgcgtgcgctcgag
cgcgggctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctgttcccg
ctgacgatcccgcaagccgtgttcgacgaagcgctcgtgatcctcgaggaagtgctgaag
gaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system