KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_5591Help
Entry
DM40_5591         CDS       T03488                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bcew00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DM40_5591
Enzymes [BR:bcew01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DM40_5591
Transporters [BR:bcew02000]
 Other Transporters
  Pores ion channels [TC:1]
   DM40_5591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3:670563..671180
Genome map
AA seq 205 aa AA seqDB search
MKLYVHPLSGHSHRARLLISLLGIEHELIEVDLAAGAHKSPEFLALNRFGQVPVLVHGDT
VIADSNAILVYLARISGNSDYLPQSPVQEAAVQRWLSVAAGEIAFGPAAARLITVFGAKF
NADEVIARAHRILALIDAELAGRDFIVGPKPTIADVALYGYVARAPEGNVDLSGYTNVAA
WLRRIEALPGFVEFVKTPVGLAAAA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctacgttcacccgctttccggtcattcgcaccgcgcccgcctgctcatctcg
ctgctcggcatcgagcacgaactgatcgaagtcgacctcgccgccggcgcgcacaagtcg
cctgaatttctggcgctgaaccgcttcggccaggtgccggtgctggtccacggggacacc
gtgatcgccgattcgaatgccatcctcgtgtatctcgcgcgcatctcgggcaacagcgac
tacctcccgcaatcgcccgtgcaggaagccgccgtgcagcgctggttgtccgtcgcggcc
ggcgagatcgcattcggcccggccgccgcgcggctcatcacggtcttcggtgcgaagttc
aacgccgacgaagtgattgcccgtgcgcatcgcatcctcgcgctcatcgacgccgaactc
gcggggcgcgacttcatcgtcgggccgaagccgaccatcgccgacgtcgcgttgtatggc
tacgttgcacgcgcgcccgaaggcaatgtggacctgtccggctatacgaacgtcgcggcg
tggctgcgccgcatcgaagcgttgccgggcttcgtcgagttcgtgaagacgccggtcggg
ctcgcggccgctgcgtga

DBGET integrated database retrieval system