KEGG   Bacillus cereus F837/76: bcf_24605Help
Entry
bcf_24605         CDS       T01703                                 

Definition
(GenBank) Superoxide dismutase (Cu-Zn) precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bcf  Bacillus cereus F837/76
Brite
Enzymes [BR:bcf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     bcf_24605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AEW58015
LinkDB All DBs
Position
complement(4641485..4642024)
Genome map
AA seq 179 aa AA seqDB search
MKKRLFFSCCLLFLMAGCDQGKPKEIDVKLHNASGDEVGTAKVTQQTSGVKITIKGEGFA
PGPHGLHVHEIGECKAPRYESAGNHFNPDDKKHGLLNPKGAENGDLPNVIADGSGKIKAE
IDAPHITLEEGKTTIHRKDGASIIITENADDGMTQPTGKSGDRIACGVIVKKASDMKKK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacggctttttttcagttgttgtttactatttctgatggcaggttgtgaccaa
ggaaagccgaaagaaattgacgtgaaattacataatgcttcaggtgatgaagtggggact
gcgaaagtaactcagcaaacaagcggggtaaaaattacgattaaaggggaaggtttcgcg
ccaggcccgcacggactacatgtacacgaaattggagagtgtaaagcacctcgttatgaa
tcagctggaaatcattttaatccagatgataaaaaacatggactactcaatccgaagggt
gcagaaaatggtgatttaccgaacgtaattgcagacggttctgggaaaattaaagcagaa
atcgatgcaccgcatataacgcttgaagaaggaaaaacgacgattcatagaaaagatgga
gcgtctattattattacagaaaacgctgatgatggtatgacacaaccgacaggtaaatca
ggtgatcgaattgcttgtggtgtcattgtaaaaaaagcgtcggatatgaagaaaaagtaa

DBGET integrated database retrieval system