KEGG   Bacillus coagulans 2-6: BCO26_1963Help
Entry
BCO26_1963        CDS       T01527                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00020  Citrate cycle (TCA cycle)
bck00480  Glutathione metabolism
bck01100  Metabolic pathways
bck01110  Biosynthesis of secondary metabolites
bck01120  Microbial metabolism in diverse environments
bck01130  Biosynthesis of antibiotics
bck01200  Carbon metabolism
bck01210  2-Oxocarboxylic acid metabolism
bck01230  Biosynthesis of amino acids
Module
bck_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bck_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCO26_1963
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BCO26_1963
Enzymes [BR:bck01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BCO26_1963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AEH54022
UniProt: F7Z0K1
LinkDB All DBs
Position
complement(1991653..1992927)
Genome map
AA seq 424 aa AA seqDB search
MAQGEKITVENGVLNTPNHPIIPFIEGDGTGPDIWAAAQRVLDAAVEKAYKGEKKIVWKE
VYAGEKAFNKTGEWLPQETLDTIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFDGVPSPVKRPQDTDMVIFRENTEDIYAGIEYKEGSPEVKKVISFLQNEMGVKKIR
FPETSGIGIKPVSKEGTERLVRAAINYAIKEGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EREFGDKVFTWSEYDRIKEEKGADAANQAQKEAEANGKIIIKDAIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLMLEHLGWNEAAKLITGSMEKTIASKVVTYDFARLMDGAREVKCSEFGDELIK
NMAE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaggagaaaagatcaccgtagaaaacggcgtattaaacacaccgaatcacccg
attattccatttatcgaaggggacggcacaggccctgatatttgggcggctgcacagcgc
gtattggatgcggctgttgaaaaggcctataaaggcgaaaagaaaattgtctggaaagaa
gtctatgcaggggaaaaagcattcaataaaacaggggaatggctgccgcaggaaacgctt
gacacgatccgcgaatatttcattgccattaaagggccgttaaccactccggtcggcggc
gggatccgttcgctgaatgttgcgctgcgccaggaactcgacttattcgtctgcctgcgc
cctgtccgttattttgatggcgtcccttccccggtcaaacgcccgcaggataccgatatg
gtcattttccgcgaaaacacggaagacatttatgccggcattgaatataaagaaggttcg
ccggaagtgaaaaaagtcatttcgtttttgcaaaatgaaatgggcgtaaaaaagatccgc
ttcccggaaacttccggcatcggcatcaaaccggtatcgaaggaaggcacggaacggctg
gtgcgcgccgcgattaactatgcgatcaaagaaggacgcaaatccgttacgctcgtacat
aaaggcaatattatgaaatttacggaaggcgcgtttaaaaactggggttatgaactggcg
gaaagggaattcggcgataaagtctttacctggtccgaatacgaccgcattaaagaagaa
aaaggcgcggatgctgccaaccaggcgcagaaggaagcagaagcaaacggcaagatcatc
atcaaagatgcgattgccgatattttcctgcagcaaattttgacccgcccgcgcgaattt
gacgtcgtggcaacgatgaacttaaacggcgactacatttcggatgcgctcgccgcacaa
gtcggcggcatcgggattgcccctggcgcgaacatcaactacgaaaccggccatgccatt
ttcgaagcgacgcacggaacggcgccgaaatatgccggcttggataaagtgaacccttca
tctgttattttgtcgggtgttttgatgctcgaacatctgggctggaatgaagcggcaaaa
ttgattaccggttcgatggaaaaaacgatcgcttccaaagttgtcacatacgactttgcc
cgcctgatggatggcgcgagggaagtcaaatgctctgaattcggcgatgaactgatcaaa
aacatggcggaataa

DBGET integrated database retrieval system