KEGG   Bacillus clausii: ABC2191Help
Entry
ABC2191           CDS       T00228                                 

Gene name
tgl
Definition
(GenBank) transglutaminase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
bcl  Bacillus clausii
Brite
Enzymes [BR:bcl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     ABC2191 (tgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2317052..2317858
Genome map
AA seq 268 aa AA seqDB search
MIEIAGKPLQTIPSHGLSQAERAILTSLLESNATYRYQSVDELSFEVALRLHTVEASIAM
FHSGASFESFQQSYCNPRFWQRMPNGAFQLKPSVRPSDAINDIFLNGRAYGFECATAIII
LFYKAVLDSIDRPSFDRLFQGLYLYSWEHDEDLQLVTRKGTDYCIGDCVYFNNPDFAPYN
SVWRGENAIKLDRDLYFGHGIGIQPSAEIIRILNEQRIPGSQTSAYLLDQVTRLNFKLVR
TFSATGYTPRTGLLDAIVVEMGERIHFY
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaattgcaggaaagccgttgcagacaataccgagccacggtctatcccaagcg
gaacgcgccattctaacaagtttgcttgaaagcaacgccacttaccgctaccaatccgtt
gatgaactcagctttgaggttgctttgcgcttacatacagtcgaagcatcaatcgccatg
tttcatagtggcgcctcattcgagtcctttcaacagtcctattgcaatccccgcttttgg
cagcgtatgcctaatggcgccttccagttaaaaccttctgtgaggccgtctgatgcgatc
aacgatatctttttaaatggcagagcctacggatttgaatgcgccactgccattatcatt
cttttttataaggcagtgctcgattcgattgaccgtccttcgtttgaccggttgttccaa
gggctgtatttgtattcatgggaacacgacgaagacttgcagctagtgacaagaaaagga
accgattattgtattggcgactgtgtttactttaacaatcccgattttgccccgtacaat
tccgtctggcgcggcgaaaacgcgattaagcttgatcgtgacttgtactttggccatggg
attgggattcaaccgagcgccgaaatcatccgtattttaaacgagcaacgcatcccaggc
tcgcaaacgtccgcttacttgctcgaccaagtaacacgtcttaactttaaattggtgcgt
acattctccgctactggctacacgccacgtactgggcttttggatgcaatcgtcgtggaa
atgggtgagcgtatccacttttactaa

DBGET integrated database retrieval system