KEGG   Baudoinia panamericana: BAUCODRAFT_38384Help
Entry
BAUCODRAFT_38384  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bcom  Baudoinia panamericana
Pathway
bcom00250  Alanine, aspartate and glutamate metabolism
bcom00410  beta-Alanine metabolism
bcom00430  Taurine and hypotaurine metabolism
bcom00650  Butanoate metabolism
bcom01100  Metabolic pathways
bcom01110  Biosynthesis of secondary metabolites
Module
bcom_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bcom00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BAUCODRAFT_38384
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAUCODRAFT_38384
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BAUCODRAFT_38384
   00430 Taurine and hypotaurine metabolism
    BAUCODRAFT_38384
Enzymes [BR:bcom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BAUCODRAFT_38384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 19113521
NCBI-ProteinID: XP_007680391
JGI: Bauco1_38384
UniProt: M2N123
LinkDB All DBs
Position
Unknown
AA seq 515 aa AA seqDB search
MVHLGKIPTDKDIEETKIPGLEDVKLDAPGQDEFTASVYGSRFAAMDLPKHEMPADEMPR
EVAYRMIKDDLSLDGTPTLNLASFVTTYMEEEAEKLMVEAFSKNFIDYEEYPVSADIQNR
CVSMIARLFNIPSHDPNVNAMGTSTIGSSEAIMLGTLAMKKRWQNKRKAAGKDYSKPNIV
MNSAVQVCWEKAARYFDVEEKYVYCTEDRFVIDPEEAVKLIDENTIGICTILGTTYTGEY
EDTKKINDLLVEKNIDCPIHVDAASGGFVAPFVHPDLVWDFRLEKVVSINVSGHKYGLVY
PGVGWVVWRDPEFLPKELIFNINYLGADQASFTLNFSRGASQVIGQYYQLIRLGKKGYRS
IMLNLTRTADYLATSVEKMGFILMSKKSGDGLPLVAFRLNPERKHKFDEFALAHQLRERG
WVVPAYTMAPHANSLKMMRVVVREDFSRSRCDALIQDIKLAYDELSKMDEHKLEQHKEHR
RAHGTRTGRHRNINTHFTDETHSLQGKHGKTHAVC
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggttcatcttggcaagatcccaactgacaaggacatcgaggagaccaagatccctggc
cttgaagatgttaagctggacgcgcccggccaggatgagttcaccgccagcgtgtacggc
tctcgcttcgcagccatggacctgccgaagcatgagatgccggccgacgagatgccccgc
gaggtcgcctaccgtatgatcaaggacgacctgtcgctggatggcactcccacgctgaac
ctcgcctccttcgtgacgacgtacatggaggaagaagcggagaagttgatggtggaagcc
ttctccaagaacttcattgattatgaagagtaccccgtcagcgccgacatccagaaccgt
tgcgtctccatgatcgcccgcctcttcaacatccccagccacgaccctaatgtcaacgcc
atgggcacctcgaccattggctcctctgaagccatcatgctcggcaccctggccatgaag
aagcgctggcaaaacaagcgtaaggccgccggcaaggactacagcaagcccaacatcgtc
atgaactccgccgtgcaggtgtgctgggagaaggccgcccggtacttcgatgtggaggag
aagtatgtctactgcaccgaagaccggttcgtcattgacccagaggaggcggtcaagctg
atcgacgagaacaccatcggcatctgcaccatcctaggcaccacctacacgggtgagtac
gaggacaccaagaagatcaacgatctcctggtggagaagaacatcgactgcccaatccac
gtcgatgccgcatcaggtggcttcgttgctcccttcgtccacccggacttggtctgggac
ttccgtcttgagaaggtcgtttccatcaacgtctctggtcacaagtacggcctcgtctat
cccggtgtcggctgggtcgtgtggcgtgacccggagttccttcccaaagaactcatcttc
aacatcaactacctcggcgccgaccaagcctccttcaccctcaacttctctcgtggcgcc
tcccaggtcatcggccagtactaccaactcatccgcctcggcaagaagggttaccgcagc
atcatgctcaacctaacccgcaccgccgactacctcgccacctccgtcgagaagatgggc
ttcatcctcatgtcgaagaagtccggcgacggccttccgctcgtcgccttccgtctcaac
ccggagcgcaagcacaaattcgatgaatttgcgctcgctcaccagctgcgcgagcgtggc
tgggtcgtcccggcgtacacgatggcgccgcatgccaactcgctgaagatgatgcgagtc
gtggtccgcgaggacttcagcaggtcaaggtgcgatgcgttgattcaggatatcaagctg
gcgtatgatgaattgagtaagatggacgagcacaagttggagcagcacaaggagcacaga
cgcgcgcatggcacgcggacgggcaggcataggaatatcaacacgcatttcacggatgag
acgcacagtttgcagggcaagcacggcaagacgcatgccgtgtgttaa

DBGET integrated database retrieval system