KEGG   Burkholderia contaminans: NL30_32850Help
Entry
NL30_32850        CDS       T03969                                 

Definition
(GenBank) DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bcon  Burkholderia contaminans
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bcon00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    NL30_32850
Enzymes [BR:bcon01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NL30_32850
DNA repair and recombination proteins [BR:bcon03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     NL30_32850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:complement(459080..461836)
Genome map
AA seq 918 aa AA seqDB search
MAGKLEPYRRKRRFDATPEPAGAPGRRRAHADADASEHDAHKARPSTRTARPLRFVIQEH
HARRLHYDFRLELDGTLKSWAVPKGPSVDPSVKRLAVHVEDHPIEYASFEGEIPAGHYGA
GSVTVWDEGTWTPDGGIGRARDGYRAGKLTFRLDGTKLHGGWALVRSGRQQGRQEQWLLI
KERDDDARDAASFDVVAQQPGSVHDGRAQASRSAPAHPPHDGGARTTAIDPSQVEGAVRA
ALPDRVAPQLATLVDAPPAHDDWRYEVKFDGYRILARIAGRGARRHVTLMTREGRDWTPK
LRVQRDALAALDVDNAWLDGEAVVLGEHGLPDFQALQNALGAGRSDAVTLFVFDLPFLDG
HDLRDAPLTARRALLEPLLAGSDPARLRYSPDLGDDVASLIASACDTGLEGLIGKRADSR
YRGGRSSAWIKLKCRRRQEFVIGGYTEPSGSRHGFGALLLGVYEPAADGKRPRRPKRPHV
APPLRYVGRVGTGFDTRLLDRLAAMLRQHERGTTPFDPPPRERSRTRVHWVEPTLVAECE
FAEWTSDGIVRQAAFIALREDKPARQIVREVPRPTETEATMNESRAAHDASPQAPHTDTA
HGPTRGARSSASSGDTQGAAAADRVGRVRITHPDRVLDPQSGTRKIDLAHYWQWVAPWLL
PDLKGRPVSLVRAPGDIAGELFFQKHAERREIPFVTQHEGLDPGHGPLLSIDSVDALLGA
AQMGTIELHTWNAHASNIERPDRIVFDLDPDPALPWRAMIDAAQLVRGLLDELGLVSFCK
TSGGKGLHVVVPLTRHAGWDDVKNFSRAVAQHVAGALPDRFTATMGPRHRRGKIFVDYLR
NGRGASTIAAYSVRARPGMGVSVPLDWDEVPDTTGGAQWTIDTLRERLDALKRDPWAGYA
HARQRITASMRARLGAET
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaagctcgaaccctatcgccgcaagcgccgcttcgatgcgacgccggaaccc
gcgggggcgcccgggcggcggcgcgcgcatgcggatgccgatgcgagcgagcacgacgcg
cacaaggcccgaccctccacgcgcacggcccggccgctgcgcttcgtgatccaggagcat
cacgcgcggcggctgcactacgacttccgtcttgaactcgacggcacgctgaagtcatgg
gcggtgccgaaagggccgagcgtcgatccgtcggtgaaacggctggccgtgcacgtcgag
gatcatccgatcgaatatgcgtcgttcgaaggcgagatcccggccggccattacggcgcg
ggctccgtcaccgtgtgggacgagggcacgtggacgcccgacggcggcattggccgggcg
cgcgacggctaccgcgcgggcaagctgacgttccggctcgacggcacgaagctgcacggc
ggctgggcgctggtgcgcagcgggcggcagcaggggcgccaggagcaatggctgctgatc
aaggaacgcgacgacgacgcgcgcgatgcggccagcttcgatgtcgtcgcgcagcagccg
ggcagcgtgcacgacggccgggcacaggcgtcgcgctcggcgcctgcccaccctccgcat
gacggcggggcgcgcacgacggcgatcgatccgtcacaggtcgaaggcgcggtacgcgct
gcattgcccgatcgcgtggcgccgcaactcgcaacgctcgtcgatgcaccgcccgctcac
gacgattggcgctacgaagtgaaattcgacggttacaggatccttgcgcggattgcaggt
cgcggtgcgcggcggcatgtcacgctgatgacgcgcgaaggtcgcgactggacgccaaaa
ctgcgtgtgcagcgcgacgcgctcgcggcgctcgacgtcgacaacgcgtggctcgacggc
gaggccgtcgtcctgggcgagcatgggctgcccgatttccaggcgctgcagaacgcgctc
ggcgcgggccgttcggacgcggtgacgctgttcgtgttcgacctgccgtttctcgacgga
cacgacctgcgcgatgcgccgctcaccgcgcggcgcgcgctgctcgaaccgctgctcgcc
ggcagcgatcccgcacggctgcgctactcgcccgatctcggcgacgacgtcgcgtcgctg
atcgcgagcgcgtgcgacaccgggctcgaagggttgatcggcaagcgcgcggattcacgc
taccgcggcggccgctcgtccgcgtggatcaagctgaaatgccggcggcgccaggagttc
gtgatcggcggctataccgagccgtcgggcagccggcacggcttcggcgcgctgctgctc
ggcgtgtacgaaccggccgcggacggcaagcggccgaggcgccccaagcggccgcatgtc
gccccgccgttgcgctatgtcggccgggtcggcaccgggttcgatacgcgtctgctcgac
cggctcgcggcgatgctgcgccagcacgaacgcggcacgacgccgttcgatccgccgccg
cgcgaacggtcccgcacgcgtgtccactgggtcgagccgacgctcgtcgccgaatgcgaa
ttcgcggaatggacgagcgacggcatcgtgcggcaggcggcgttcatcgcgctgcgcgaa
gacaagccggcgcggcagatcgtccgcgaagtgccacggccaaccgaaacggaggcaacg
atgaacgaatcccgcgcggcgcacgacgcttccccgcaagccccgcataccgataccgcg
cacggtcccacgcgcggcgcgcgatcgtccgcgtcttccggcgacacgcagggtgcggcc
gccgccgatcgtgtcggccgcgtgcgcatcacgcatcccgatcgggtgctcgatccgcaa
agcggcacgcgcaagatcgacctcgcgcactactggcaatgggtcgcgccgtggctgctg
ccggacctgaagggccggcccgtgtcgctcgtgcgcgcaccgggcgacatcgccggcgaa
ctgttcttccagaagcatgccgagcgccgcgagatcccattcgtcacgcagcacgaaggg
ctcgatcccggccacgggccgctgctgtcgatcgacagcgtcgatgcgctgctcggcgcc
gcgcagatgggcacgatcgagctgcacacgtggaacgcgcacgcgtcgaacatcgagcgg
ccggaccgcatcgtgttcgacctcgatcccgatccggcgctgccgtggcgcgcgatgatc
gacgccgcgcagctcgtgcgcgggctgctcgacgagctggggctcgtctcgttctgcaag
acgagcggcggcaaggggctgcacgtcgtcgtaccgctcacgcggcatgcgggctgggac
gatgtgaagaatttctcgcgtgcggtggcgcagcacgtcgcgggtgcgctgcccgaccgt
ttcacggcgacgatggggccgcgccatcggcgcggcaagatcttcgtcgactacctgcgc
aacggccgcggcgcgagcacgatcgccgcgtattcggtgcgcgcgcggcccggcatgggc
gtatcggtgccgctcgactgggacgaggtgcccgacacgacgggcggtgcgcaatggacg
atcgacacgctgcgcgaacgcctcgatgcgttgaagcgtgatccgtgggcaggctatgcg
cacgcgcggcagcgcatcaccgcgtcgatgcgcgcccggctgggtgctgaaacgtga

DBGET integrated database retrieval system