KEGG   Beutenbergia cavernae: Bcav_0664Help
Entry
Bcav_0664         CDS       T00893                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
Organism
bcv  Beutenbergia cavernae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ACQ78926
UniProt: C5BY32
LinkDB All DBs
Position
740917..741921
Genome map
AA seq 334 aa AA seqDB search
MAREASDAVELEIADKVVRLTHPDRVYFPEHGYTKRDLAEYYVAVGDGIVRALRERPCML
HRFPKGIAEKKVHQKRVPAGAPPWVRTVRVEFPRYGRHAYELCVTEPAQVIWAVQMSTVE
FHPWNSRAADTEKPDEWRIDLDPGPDCPFSRVQRVAGVVHEVLDELGAVGWPKTSGGSGL
HIYVRIEPRYGFKDVRRAALAFAREIERRAPDDVTTTWWTRDRDPALLFVDYNQNARDHT
IAAAYSVRGVPDARVSAPITWAEVPDVDPHDFTIGTMPDRFEALGDLHAGIDDAVFSIEP
LLEWAERDERAGADAGGPTDEADDADESDQEEHA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgaggcgagtgacgccgtcgagctcgagatcgccgacaaggtcgtccgcctc
acgcacccggaccgcgtgtacttcccggagcacgggtacacgaagcgggacctcgcggag
tactacgtggccgtgggtgacgggatcgtccgtgccctgcgggagcggccgtgcatgctg
caccggttcccgaagggcatcgcggagaagaaggtccaccagaagcgcgtgcccgccggg
gcgccaccgtgggtgcggacggtgcgggtcgagttcccgcgctacggccggcacgcgtac
gagctgtgcgtgaccgagccggcgcaggtgatctgggcggtccagatgtcgacagtcgag
ttccacccctggaactcccgcgccgccgacaccgagaagcccgacgagtggcgcatcgac
ctcgacccggggccggactgcccgttctcccgcgtgcagcgcgtggccggcgtcgtgcac
gaggtgctggacgagctgggcgcggtggggtggccgaagacgtcgggcgggtcggggctg
cacatctacgtgcggatcgagccgcggtacgggttcaaggacgtgcggcgtgctgcgctg
gcgttcgcgcgggagatcgagcgtcgggcgcccgacgacgtcacgacgacgtggtggacc
cgcgacagggatccggcgctgctgttcgtcgactacaaccagaacgcgcgcgaccacacg
atcgccgccgcctactcggtccgcggggtgccggacgcgcgggtgtccgcaccgatcacg
tgggcggaggtgcccgacgtcgacccgcacgacttcacgatcggcacgatgccggaccgc
ttcgaagcgctcggcgacctgcacgccgggatcgacgacgcggtgttctccatcgagccg
ttgctcgagtgggcggagcgggacgagcgcgcgggcgccgatgccggtggccccacggac
gaggcggacgacgcggacgagtcggaccaggaggagcacgcatga

DBGET integrated database retrieval system