KEGG   Bacillus cytotoxicus: Bcer98_0102Help
Entry
Bcer98_0102       CDS       T00560                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
bcy  Bacillus cytotoxicus
Brite
Translation factors [BR:bcy03012]
 Eukaryotic Type
  Elongation factors
   Bcer98_0102
 Prokaryotic Type
   Bcer98_0102
Mitochondrial biogenesis [BR:bcy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Bcer98_0102
Exosome [BR:bcy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bcer98_0102
  Exosomal proteins of breast cancer cells
   Bcer98_0102
  Exosomal proteins of colorectal cancer cells
   Bcer98_0102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
125691..126878
Genome map
AA seq 395 aa AA seqDB search
MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLAKAGGAEARGYDQIDAAPEERERG
ITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYEFPGDDIPVVKGSALKALE
GDAEWEAKIVELMAEVDAYIPTPERETDKPFLMPVEDVFSITGRGTVATGRVERGVVKVG
DVVEIIGLAEETASTTVTGVEMFRKLLDQAEAGDNIGALLRGVAREDIQRGQVLAKPGSV
KAHAKFKAEVYVLSKEEGGRHTPFFANYRPQFYFRTTDVTGIIQLPEGTEMVMPGDNVEM
TVELIAPVAVEEGTKFSIREGGRTVGAGVVASIIE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaattcgaacgttcaaaaccccatgttaacattggtacaattggccac
gttgaccatggtaaaactacattaactgctgcaatcactacagttcttgcaaaagctggt
ggtgctgaagcacgcggatacgatcaaatcgacgctgctccagaagaaagagagcgcggt
atcacaatctcaactgcacacgttgagtacgaaactgaaactcgtcactatgcacacgtt
gactgcccaggacacgctgactatgttaaaaacatgatcactggtgctgctcaaatggac
ggcggtatcttagtagtatctgctgctgatggtccaatgccacaaactcgtgagcacatc
cttctttctcgtcaagtaggtgtaccttacatcgttgtattcttaaacaaatgcgacatg
gtagacgacgaagaattactagaattagtagaaatggaagttcgtgatctattatctgaa
tacgaattcccaggagatgacatccctgtagttaaaggttctgctcttaaagctcttgaa
ggagatgctgagtgggaagctaaaatcgttgagttaatggctgaagttgatgcttacatc
ccaactccagaacgtgaaactgacaaaccattcttaatgcctgtagaggatgtattctct
atcacaggtcgtggtacagttgctactggtcgcgtagagcgcggtgtagttaaagttggt
gacgtagtagaaatcatcggtcttgctgaagaaactgcttctacaactgtaacaggtgta
gaaatgttccgtaagcttcttgaccaagctgaagctggtgacaacatcggtgctctactt
cgtggggttgctcgtgaagacatccaacgtggacaagttcttgctaaaccaggctctgta
aaagctcacgctaaattcaaagctgaagtttacgttttatctaaagaagaaggtggacgt
cacactccattcttcgctaactaccgcccacaattctatttccgtacaactgacgtaact
ggtatcatccaattaccagaaggtactgaaatggtaatgcctggcgacaacgttgaaatg
actgttgaacttatcgctcctgtagcagtagaagagggaactaagttctctatccgtgaa
ggcggacgtactgtaggtgctggtgtagttgcttctatcatcgaatag

DBGET integrated database retrieval system