KEGG   Brachypodium distachyon: 100825019Help
Entry
100825019         CDS       T01717                                 

Definition
(RefSeq) alanine aminotransferase 2
  KO
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
bdi  Brachypodium distachyon
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100825019
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100825019
   00220 Arginine biosynthesis
    100825019
Enzymes [BR:bdi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     100825019
Amino acid related enzymes [BR:bdi01007]
 Aminotransferase (transaminase)
  Class I
   100825019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 481 aa AA seqDB search
MASSVAVENLNPKVLKCEYAVRGEIVIHAQRLQQQLQNQPGSLPFHEILYCNIGNPQSLG
QQPVTFFREVLALCDHPYLLQREEIKSLFSADSISRAKQILALIPGRATGAYSHSQGIKG
LRDAIAAGITARDGFPANADDIFLTDGASPGVHLMMQLLIRNEKDGILVPIPQYPLYSAS
IALHGGALVPYYLNESTGWGLEISDVKKQLEDARSRGIDVRALVVINPGNPTGQVLAEEN
QYDIVKFCKNEGLVLLADEVYQENIYVDDKKFHSFKKIVRSLGYGEDLPLVSYQSVSKGY
YGECGKRGGYMEITGFSAPVREQIYKISSVNLCSNITGQILASLVMNPPKAGDESYASYQ
AEKDRILTSLARRAKALEDAFNNLEGITCNKAEGAMYLFPRINLPQKAIDAANAANKAPD
AFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIISRFKVFHEAFMAEHR
D
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagcgtcgccgtggagaacctaaaccccaaggttttaaagtgtgagtatgct
gtgcgtggagagatagtcatccatgctcagcggttgcaacaacagctacagaatcaacct
ggatctctaccttttcatgagatcctatattgcaacattgggaacccacagtctcttggt
cagcaaccagttacattcttcagggaggttcttgcactttgtgatcatccatacttgttg
caaagagaggaaatcaaatcattgttcagtgctgattctatttctcgggcaaagcagatt
cttgccttgatacccggaagagcaacaggggcatacagccatagccagggtattaaaggt
cttcgggatgcaattgctgctgggatcactgcacgagatggattccctgctaatgcagat
gacatttttcttacagatggagcaagtcctggggtgcacttgatgatgcagttactgatc
aggaatgagaaagatggcattcttgtcccaattccacagtatcccttgtactcagcctcc
atagcccttcatggtggagctcttgtcccatattatcttaacgaatcgacaggctggggt
ttggaaatctctgatgttaagaagcaacttgaagatgctcggtcaagaggcatcgatgta
agggctttggtcgttatcaatccaggaaatccaaccggacaggttcttgctgaggaaaat
cagtatgacatagtgaagttctgcaaaaacgagggtcttgttcttctggctgatgaggta
taccaagagaatatctatgttgacgataagaaatttcactctttcaagaagatagtaaga
tccttgggatacggagaggatctccctctagtatcatatcaatctgtttctaagggatat
tatggagagtgtggtaaaagaggaggttacatggagattactggcttcagtgctccagta
agagagcagatctacaaaatatcatcagttaacttatgttccaatatcactggtcagatc
cttgctagtctcgtcatgaacccaccaaaggctggggatgaatcatacgcttcctatcag
gcagaaaaggatagaatccttacgtctctagctcgtcgtgcgaaggcactggaggatgca
ttcaacaatcttgaggggattacatgcaacaaggctgaaggagcaatgtacctattccct
cggattaatctgccacaaaaggcaatcgatgctgctaatgctgctaacaaagcacctgat
gcattctatgctcttcgtctccttgagtcaacgggaatcgttgttgtgcccggatctgga
tttggccaagttcctggcacatggcacttcagatgcacaatccttccacaggaggagaag
atcccggcgattatctcccgcttcaaggtgttccatgaagcgttcatggcggagcaccgc
gactaa

DBGET integrated database retrieval system