KEGG   Brachypodium distachyon: 100834519Help
Entry
100834519         CDS       T01717                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHR3-like
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
bdi  Brachypodium distachyon
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100834519
Enzymes [BR:bdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100834519
Chromosome [BR:bdi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100834519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 490 aa AA seqDB search
MAAIAPTSGRTLEDHAKEWAARKVASGAALHHCVLPFLTGAPKAVECRLCNKIIYPLEEI
KCSVSRCEQMFHLTCAVENATNLTTESFKCPQHGCMVCKQKTFFWRCGRCTVAAHTKCAP
WPLIHLKDDQGSAICWRHPSNWLLQNENADLTNNIEEVFCRLPLPYVNEEFNIDSTIRDF
TAIVCKPPSYIHIRRNVYLVKKKRADSSAETGCTNCRADSVCKDDCECRGLSMSCSKSCH
CSDLCTNKPFRKDKKIKIVKSEGCGWGAIALEPLEKCDFIIEYVGEVIDDATCEQRLWEM
KRRGDKNFYMCEISKDYTIDATFKGNTSRFLNHSCDPNCKLEKWQVDGETRVGVFASRFI
EVGEPLTYDYRFVHFGEKVKCHCGAKSCQGYLGSQLKNPTQDALAAASQLLTQGSFSPSR
LKPETHLLPWTNCIEVPFNLRSKTKIDRLCWGRKRQRTSLVDPSAGSMQTSDIEAAASVT
ELSRGGAAGS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaattgcgccgacatccggtcggacgcttgaggatcatgcaaaggagtgggcg
gcgcggaaggtagcttcaggtgctgccctgcaccattgtgtgttgccattcctcactggt
gcgcccaaagcggttgaatgtcgtttgtgcaataagattatctatccattggaagaaata
aaatgttcggttagccgttgtgaacaaatgttccatctgacctgtgcggtggaaaatgct
acaaatctaaccacagaaagcttcaagtgccctcaacatggctgcatggtttgtaagcaa
aagacgtttttttggcgctgtggacgttgtacagttgcagcacatacaaaatgtgcaccg
tggccgctaattcatctaaaagatgaccaaggaagtgcaatttgctggagacacccttct
aattggctccttcaaaatgagaatgctgacctgacaaacaacatagaggaagtcttctgt
cggctacctctgccatatgtcaatgaagaattcaatattgattcaaccattagggacttc
acggcaattgtttgcaaaccaccctcatatatacatatcaggcgcaatgtatatttagta
aagaagaaacgagccgattcaagtgcggagactgggtgcacaaattgcagagcagattct
gtttgcaaagatgattgtgaatgcaggggtctttctatgagttgttccaagagttgccac
tgctcagatctatgtaccaacaagccattccgcaaggataagaaaattaaaattgtcaag
tcagaaggctgtggatggggtgctattgcattggagccgttggagaaatgtgattttatt
atcgagtatgttggtgaagtcattgatgatgcaacatgtgagcagcggctttgggagatg
aaacggcgtggtgacaaaaatttctacatgtgtgaaatcagcaaagattatacaatagat
gcaacatttaaaggaaatacttcacgttttctaaaccatagttgtgatccaaactgtaaa
ctagaaaaatggcaagttgatggtgagacaagagtcggtgtttttgcctctcgtttcatc
gaagttggagagcccttaacttatgattacaggtttgtgcattttggggagaaggtcaag
tgccactgcggtgcaaagagttgccaaggatatttgggcagccagctaaagaatccaacg
caggatgctcttgcagctgcaagccagttgctcacgcaaggcagcttctccccttcaaga
cttaaaccagagactcacttgttaccctggaccaactgtatagaggttcctttcaatttg
aggagcaaaacgaaaatagaccggctatgctggggacgcaaacggcagaggacgtccctc
gtagacccttctgcaggaagcatgcagacatcggatattgaagctgctgcatccgtgact
gaactgtcgagaggcggagccgcgggctcatga

DBGET integrated database retrieval system