KEGG   Brachypodium distachyon: 100836533Help
Entry
100836533         CDS       T01717                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 1-like
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bdi  Brachypodium distachyon
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100836533
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100836533
Enzymes [BR:bdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     100836533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 973 aa AA seqDB search
MASSNSKSMERHHSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREFV
QDCYEVSAEYEGDRDAGRLEELGRRLTGLAPADAIVVASSFSHMLNLANLAEEVQIASRR
RNKVSKRGDFADEASATTESDIEETLKRLVSGLGKSRQEVFDALKNQTVDLVFTAHPTQS
IRRSLLQKHGRIRNCLTQLYAKDITADDKQELDEALQREIQAAFRTDEIRRTQPTPQDEM
RAGMSYFHETIWKGVPKFLRRVDTALKNIGVDERLPYNAPLIQFSSWMGGDRDGNPRVTP
EVTRDVCLLARMTAANLHFSQIEELMFELSMWRCNDELRVRAEELHRVSRKAEKHYIEFW
KQVPPTEPYRVILGYVRDKLYYTRERSRHLLTSGFSDIPADSTFTNVEEFLEPLELCYRS
LCASGDKTIADGSLLDFLRQVSTFGLSLVKLDIRQESERHTDALDAITTHLGIGSYRSWP
EEKRQEWLLSELRGKRPLLGLRGDLPDTTDEVADVLGTFRVLAELPADCFGAYVISMATA
PSDVLAVELLQRECHVAHPLRVVPLFEKLADLESAPAAVARLFSIDWYMERIGGKQEVMI
GYSDSGKDAGRLSAAWQLYKAQEELVEVAKRHGVKLTMFHGRGGTVGRGGGPTHLAILSQ
PPETVHGSLRVTVQGEVIEHSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDE
MAVVATEEYRSMVFKEPRFLEYFRSATPETEYGRMNIGSRPSKRKPGGGIETLRAIPWIF
AWTQTRFHLPVWLGFGAAFKHAMRKDIRNIQALREMYNEWPFFRVTLDLLEMVFAKGDPG
IAALYDELLVADDLKPLGEQLRSNYEDTKKLLIQVAGHKDVLEGDPYLKQRLRLRDPYIT
TLNVCQAYTLKRIRDPGFQVTTQPPLSKEFADENRPASASLVKLNAASEYAPGLEDTLIL
TMKGIAAGMQNTG
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgtccaactccaagtccatggagcggcaccactccatcgacgcccagctccga
ctcctggcacccggcaaggtctctgaggacgacaagctcgtcgagtacgacgccctcctc
gtcgaccgtttcctcgacatcctccaggacctccacggcccacacctccgcgaattcgtg
caggattgctacgaggtgtcggcggagtacgagggcgaccgggacgcggggcggctggag
gagctggggcgcaggctgacggggctggcgcccgcggacgccatcgtggtggccagctcc
ttctcccacatgctcaacctggccaacctcgccgaggaggtgcagatcgccagccgccgc
aggaacaaggtcagcaagcggggggacttcgcggacgaggcgtccgccaccaccgagtcc
gacatcgaggagacgctcaagaggctcgtctccggcctcggcaagtcccgccaggaggtc
ttcgacgcgctcaagaaccagaccgtggacctcgtcttcaccgcacaccccacgcagtcc
atccggaggtcgctcctccagaagcacggaaggattcggaattgcctgacgcagctgtat
gccaaggacatcacggctgacgacaagcaggaactcgatgaggctcttcagagggagatt
caagctgcatttcgaactgatgaaatacgaagaacgcagcccactccgcaggatgaaatg
cgtgccgggatgagctacttccatgaaactatatggaaaggtgtaccaaagttcttgcgc
cgtgtggatacagctctgaagaatatcggagtcgatgagcgtcttccctacaatgctcca
ctcattcagttttcgtcttggatgggtggtgaccgtgatggaaatcccagagttacacca
gaggtgacaagggatgtatgcctgttggccagaatgacggctgctaacttgcacttctct
cagatagaagagctcatgtttgagctctcaatgtggcgatgcaacgatgaacttcgtgtc
cgcgctgaggaactacaccgtgtttcgaggaaagctgaaaaacattacatagagttctgg
aagcaagttcccccgactgaaccttaccgtgtgatccttggctatgtacgtgacaaatta
tactacacgcgcgaacgttcacgccatctgttgactagcggattttccgacatccctgca
gactctaccttcaccaacgtcgaagagttcctggagccactggagctctgctaccgatca
ctgtgcgcgtccggcgacaagacgatcgccgacgggagccttctggacttcctgcggcag
gtgtcgaccttcgggctgtccctggtgaagctggacattcggcaggagtcggagcggcac
acggacgccctggacgcgatcaccacgcaccttggcatcgggtcgtaccggtcgtggccc
gaggagaagcggcaggagtggctgctgtcggagctgaggggcaagcgcccgctcctgggc
ttgcgcggcgacctccccgacaccacggacgaggtcgcggacgtcctgggcaccttccgc
gtcctcgcggagctccccgcggactgcttcggcgcctacgtcatctccatggccacggcc
ccgtccgacgtgctggccgtggagctcctgcagcgggagtgccacgtggcgcacccgctg
agggtggtcccgctgttcgagaagctggccgacctggagtccgccccggccgccgtggcg
cggctcttctccatcgactggtacatggagcggatcggcggcaagcaggaggtcatgatc
gggtactcggactccggcaaggacgccggccggctgtcggcggcgtggcagctctacaag
gcgcaggaggagctcgtggaagtggcgaagcggcacggcgtgaagctcaccatgttccac
gggagaggggggactgtcggaaggggcggcgggcccacccacctggccatcctgtcgcag
ccgccggagaccgttcacgggtcgctgagggtcacggtgcagggagaggtcatcgagcac
tccttcggggaggagcacctctgcttcaggactctgcagcggttcacggccgccacgctc
gagcacggcatgcacccgccggtctcccccaagcccgagtggcgcgctctcatggacgag
atggccgtcgtggccaccgaggagtaccgctccatggtcttcaaagagcctcgattcctc
gagtacttcagatcggcgacacctgagactgagtacggtaggatgaacatcgggagccgg
ccgtcaaagaggaagcctggcgggggcatcgagacgctgcgcgcgatcccgtggatcttc
gcctggacccagacgcggttccacctccccgtgtggctggggttcggcgccgctttcaag
cacgcgatgcgcaaggacatcaggaacatccaggctctcagggagatgtacaacgagtgg
cccttcttcagggtcactctcgacttgctcgagatggttttcgccaagggagaccccggc
atcgcggccttgtacgacgaattgctcgtcgccgatgatctcaaacccctcggggagcag
ctgaggagcaactatgaggacacgaagaagctcctcatccaggttgctggtcataaggat
gttctggaaggagacccttacctgaagcagcggctgcggctgcgtgacccgtacatcaca
accctcaacgtctgtcaggcctacacactgaagcggatcagggacccagggttccaagtg
acgacgcagccgccgctgtccaaggagtttgccgacgagaaccggccagcctcagcctca
ctggtcaagctcaacgcggcgagcgagtacgcaccgggactggaggacacgctcatcctc
accatgaagggcatcgctgccggcatgcagaacacgggctag

DBGET integrated database retrieval system