KEGG   Brachypodium distachyon: 100846750Help
Entry
100846750         CDS       T01717                                 

Definition
(RefSeq) probable glutathione S-transferase GSTU1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bdi  Brachypodium distachyon
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100846750
Enzymes [BR:bdi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100846750
Transporters [BR:bdi02000]
 Other Transporters
  Pores ion channels [TC:1]
   100846750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 228 aa AA seqDB search
MAGEKKGLTLLDFWVSPFGQRVRIALEEKALPYEYVEENLLAGKSELLLRSNPVHKKIPC
LLHDGRPVNESLIIVQYLDEAFPDTRQLLPPHAAADPYARAQARFWADYVDKKVYDCGTR
LWKLKGEPQVQAREEMKEILRTLEAELGEKEFFGGEHGFGFVDAAFAPFTAWFHSYEKFG
EFSLEEVAPKLAAWAKRCGQRESVAKSLYSPEKVYEFIGVLKKKYGVE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgagaagaagggcctgacgctgctggacttctgggtgagcccgttcgggcag
cgggtccggatcgcgctggaggagaaggcgctcccctacgagtacgtggaagagaacctc
ctggccggcaagagcgagctcctcctccggtccaacccggtccacaagaagatcccctgc
ctcctccacgacggccgccccgtcaacgagtccctcatcatcgtccagtacctcgacgaa
gccttccccgacacccgccagcttcttcccccccacgccgccgccgacccttacgcgcgc
gcgcaggccaggttctgggccgactacgtcgacaagaaggtctacgactgcggcacccgg
ctctggaagctcaagggggaaccccaggtgcaggcgcgggaggagatgaaggagattctg
aggaccctggaggcggagctcggggagaaggagtttttcggtggggaacacgggttcggg
ttcgtggatgccgccttcgcgccgttcacggcgtggttccatagctatgagaagttcggg
gagttctccttggaggaggttgcgccgaagctggcggcgtgggcgaagcggtgcggccag
cgggagagcgtcgccaagagcctctactcgccggagaaggtgtatgagttcatcggcgtg
ctcaagaagaagtacggcgtcgagtaa

DBGET integrated database retrieval system