KEGG   Burkholderia dolosa: AK34_659Help
Entry
AK34_659          CDS       T03793                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bdl  Burkholderia dolosa
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bdl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AK34_659
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AK34_659
   00680 Methane metabolism
    AK34_659
Enzymes [BR:bdl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AK34_659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(717961..720999)
Genome map
AA seq 1012 aa AA seqDB search
MKSSGSARTARRNAALPPSDAQTGTVAAAANGRAKPANQPATKPKDPIRPTKRTATAAGT
AVRAAARTAAAPKSGARTREDKDRPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTA
VKFRREDDNEAAQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAG
SAPQPGTVAYALEQLKTTGNASKRLLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIAR
LLAERDQPLTARERAHNEAMLRARVTALWQTRMLRDARLTVGDEIENALSYYRATFLDEL
PALYGDIEAALAEHGLPARVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVILEHY
LEQVHKLGAELSVSNLLVGASDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARV
RLGEGTVPVRSAGRGAPPVRATPYADADEFVADLKVLTASLDEHHGASLAAPRLAPLVRA
AEVFGFHLASIDLRQSSDVHEAVVAELFARAGVEANYAALAEEDKLRVLLAALADPRPLR
SPYLEYSALAQSELGVFEKARDVRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLLE
GTLGTPGSHAKNALMVIPLFETIPDLRDASRIMREYFALPGVDTLIAHQGAEQEVMLGYS
DSNKDGGFLTSNWELYRAELALVDLFRERKITLRLFHGRGGTVGRGGGPTYQAILSQPPG
TVNGQIRLTEQGEVIASKFANPEIGRRNLETVVAATLEASLLLQSNAPAQLPAFEAAMQT
LSDAAMAAYRALVYETPGFTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRRIEDLRAI
PWGFSWGQCRLLLTGWYGFGSAVSAYLDGAHDEAERTKRLALLKKMNKTWPFFSNLLSNM
DMVLAKTDLAVASRYAQLVADRKLRKHVFERIVAEWERTSRALAEITGHDTRLATNPLLA
RSIKNRFPYLDPLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgtacggcgcgccgcaatgctgccctgcctccctccgac
gcccagacgggcaccgtcgccgccgccgcgaacggccgtgcgaaaccggcaaaccaaccg
gcaacgaaaccgaaagacccgatacgtccgacgaaacgaacggcaaccgcggccggcacc
gccgtgcgcgccgccgcccgcacggccgccgcgccgaagtccggcgcgcgcacgcgcgaa
gacaaggatcgcccgctgttcgaggacatccgcttcctcggccgcctgctcggcgacgtc
gtgcgcgagcaggaaggcgacacggtgttcgacgtcgtcgagacgatccgccagaccgcg
gtgaagtttcgccgcgaggacgacaacgaagccgcgcagacgctcgagaagaagctgcgc
aagctgacgcccgagcagacggtgagcgtcgtgcgcgcgttcagctatttctcgcacctc
gcgaacatcgcggaagaccgccaccacaaccgccgccgccgcatccacgcactggccggc
tccgcgccgcagccgggcacggtcgcgtacgcgctcgagcagctgaagacgaccggcaac
gcatcgaagcggctgctgcagcgcttcttcgacgatgcgctgatcgtccccgtgctgacc
gcgcatccgaccgaagtgcagcgcaagagcatcctcgacgcgcagcacgacatcgcgcgg
ctcctcgccgagcgcgaccagccgctgaccgcgcgcgaacgcgcgcacaacgaggcgatg
ctgcgcgcgcgcgtgaccgcgctgtggcagacgcgcatgctgcgcgacgcgcggctgacg
gtcggcgacgagatcgagaacgcgctgtcgtactaccgcgcgacgttcctcgacgaactg
cccgcgctgtacggcgacatcgaagccgcgctcgccgagcacgggctgcccgcgcgcgtg
cccgcgttcttccagatgggcagctggatcggcggcgatcgcgacggcaacccgaacgtg
acggccgcgacgctcgacgaagcgatcaaccgccaggccgccgtgatcctcgagcactat
ctggaacaggtgcacaagctcggcgccgaactgtcggtgtcgaacctgctggtcggcgca
agcgacgcggtgaaggcgctcgcggcggcgtcgcccgaccagtcgccgcatcgcgtcgac
gagccgtaccgccgcgcgctgatcggcatctacacgcggctcgcggcaagcgcgcgcgtg
cggctcggcgaaggcacggtgccggtgcgcagcgcggggcgcggcgcgccgcccgtgcgc
gcgacgccgtatgcggatgccgacgagttcgtcgccgacctgaaggtgctgaccgcgtcg
ctcgacgaacaccacggcgcgtcgctcgccgcgccgcgcctcgcgccgctcgtgcgcgcg
gccgaagtattcggcttccatctcgcgagcatcgacctgcgccagagctcggacgtccac
gaagccgtcgtcgcggagctgttcgcgcgcgcgggcgtcgaagcgaattacgcggcgctc
gccgaggaagacaagctgcgcgtgctgctcgcggcgctcgccgatccgcgcccgctgcgt
tcgccgtatctcgagtattcggcgctcgcccaaagcgagctcggcgtgttcgagaaagcg
cgcgacgtgcgtgcgcaattcggcgcgcgcgcggtgcgcaactacatcatttcgcatacg
gaaaccgtcagcgacctcgtcgaagtgctgctgctgcagaaggagacggggctgctcgaa
ggcacgctcggcacgccgggcagccacgcgaagaacgcgctgatggtgatcccgctgttc
gagacgatccccgatctgcgcgacgcgtcgcggatcatgcgcgaatacttcgcgctgccg
ggcgtcgacacgctgatcgcgcaccagggcgccgaacaggaagtgatgctcggctattcg
gacagcaacaaggacggcggcttcctcacgtcgaactgggagctgtaccgcgcggagctc
gcgctcgtcgacctgttccgcgagcgcaagatcacgctgcggctgttccacggccggggc
ggcacggtcggccgcggcggcggcccgacctatcaggcgatcctgtcgcagccgccgggc
accgtgaacggccagatccggctgaccgaacagggcgaagtgatcgcgagcaagttcgcg
aacccggagatcggccggcgcaacctcgaaacggtggtcgccgcgacgctcgaagcgtcg
ctgctgctgcagtcgaacgcgcccgcgcagctgcccgcgttcgaagccgcgatgcagacg
ctgtccgacgcggcgatggccgcgtatcgtgcgctcgtctacgagacgccgggcttcacc
gactacttcttctcgtcgacgccgatcaccgagatcgccgagctgaacatcggcagccgc
cctgcgtcgcgcaagctgcaggatccgaagaaccggcgcatcgaagacctgcgcgcgatt
ccgtggggcttctcgtggggccagtgccggctgctgctgaccggctggtacggtttcggc
agtgcggtcagcgcgtatctcgacggcgcgcatgacgaggccgagcgcaccaagcgcctc
gcgctgctgaagaagatgaacaagacctggccgttcttctcgaacctgctgtcgaacatg
gacatggtgctcgcgaagaccgatctcgcggtcgcatcgcgctatgcgcagctcgtcgcc
gatcgcaagctgcgcaagcacgtgttcgagcggatcgtcgccgaatgggagcgcacgtcg
cgcgcgctcgccgaaatcaccgggcacgacacgcggctcgcgacgaacccgctgctcgcg
cgctcgatcaagaaccgcttcccgtatctcgatccgctgaaccatctgcaggtcgagctg
atcaagcgtcaccgcgcgggcgacacgaacgcgcgactgcgccgcgggatccatctgacg
atcaacgggatcgcggccggcctgcgcaacaccggctga

DBGET integrated database retrieval system