KEGG   Bifidobacterium dentium JCM 1195 = DSM 20436: BBDE_0021Help
Entry
BBDE_0021         CDS       T04222                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bdn  Bifidobacterium dentium JCM 1195 = DSM 20436
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bdn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBDE_0021
  Energy metabolism
   00680 Methane metabolism
    BBDE_0021
Enzymes [BR:bdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BBDE_0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(23780..26536)
Genome map
AA seq 918 aa AA seqDB search
MTTNDQQITPADAAIVSSGTGTKGPEERDLPASLKEEMDLCLQILREVLGEFDEQLLASF
DEVRGYALNASAERFAGILTDTNPDQDDLQNVVNTVDKLDMHDAQLLARAFATYFHLANL
CEENYRVSVLHKRETAVDENQAVDPVNEMTGAYHQLINELGPAKARDLLDKLEFHPVFTA
HPTEARRKAVEGKIRRISRLLEAHKLLGGSDKKENSRRLFNEIDALFRTSPIALKKPTPV
EEADTILDIFDNTLFYTIPQVYRRFDDWVLGDKAGLVPPMCPAFFHPGSWIGSDRDGNPN
VTAKVSRQVARKFSDHVLGALEIETRTVGKNLTMEAGTTPPSDELKSLWNHQKEMSERLT
DKAALISTKEMHRAVMLVMADRLHYTIERDADLMYHSCDEFLEDLKIVQRSLAAANAKRS
AYGPVQDLIWQTETFGFHMVEMEFRQHSVVHSRALEDIREHGLHGERGPLQPMTHEVLDT
FRALGAIQKRNGIKAARRYIISFTKSAQNIKDVYELNRLAFSHPEDVPTIDVIPLFEQLE
DLQNSVDVLEDMIKIPEVQARLKATGGKLEVMLGYSDSSKDAGPTSATLALHSAQERIAK
WAESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPAL
AIRHVESVAAATLLQSAPSVEKRNTDMTEKYADMANKLDEAAHNRFLDLLNTPDFAPWFS
TVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEQFG
DLKTLRQAYEEWPLFSTFIDNIEMSLAKTDERIAKMYLALGDREDLNKKVLDEMELTREW
VLKIVGDEWPLQHRHVLGQAIRIRSPYVDALSVTQVLALGSLRKQVDKEELTHGQQENYT
YLILCTVSGVAAGLQNTG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccaacgatcaacagatcacgccagcggacgcggccatcgtctcgtccggcacc
ggaaccaagggtcccgaagagcgcgatcttccagcatctctcaaagaggaaatggatctg
tgcctgcagattcttcgcgaagtcctcggcgaattcgacgaacagctgttggcaagcttc
gatgaagttcgtggctatgccttgaacgccagcgccgaacgcttcgccggcattctgacg
gacaccaaccccgatcaggacgatctgcagaacgtggtcaacaccgtcgacaagctggac
atgcatgacgcccagctgctggctcgtgcattcgcaacatatttccatctggccaacctg
tgtgaggagaactaccgagtctccgtgctgcacaagcgcgaaaccgccgtggacgagaac
caggccgtcgatccggtgaacgaaatgaccggcgcctatcatcagctcattaacgagctg
ggtccggccaaggccagggatctgcttgacaagctcgagttccacccggtgttcaccgca
catccgaccgaggcgcgccgtaaggccgtggaaggcaagatccgccgcatctcccgcctg
cttgaggcgcataagctgctcggcggctcggacaagaaggaaaattcccgccgtctgttc
aatgagatcgacgccttgttccgcacttccccgatcgcgctgaagaagccgacccctgtc
gaggaagcggatacgattctcgacatcttcgacaacacgctgttctataccattccccag
gtctaccgtcgtttcgacgattgggtgcttggcgacaaggccggcttggttccgccgatg
tgcccggcgttcttccatccgggaagctggatcggttccgaccgcgacggcaacccgaat
gtcaccgccaaggtaagccgtcaggtggcccgcaagttcagcgatcatgtgctgggcgca
ctggagattgagacccgcaccgtcggcaagaacctgacgatggaggccggcaccactccg
ccaagcgacgagctcaagagcctgtggaaccaccagaaggagatgagcgagaggctcacc
gacaaggccgccctgatttccaccaaggaaatgcatcgcgccgtcatgctggtcatggcc
gaccgtctgcactacaccatcgagcgtgacgccgacctgatgtaccactcctgcgatgaa
ttcctggaggatctgaagattgtccagcgttccctggctgcggccaacgccaagcgttcc
gcttacggcccggtgcaggatctgatctggcagacggaaaccttcggcttccatatggtc
gagatggagttccgtcagcattccgtggtgcattcgcgcgcgctggaagacatccgcgag
catggtctgcacggcgaacgtggaccgctgcagccgatgacccacgaggtgctcgacacc
ttccgtgcgctcggcgccatccagaagcgcaatggcatcaaggccgcccgccgttacatc
atctccttcaccaagagcgcccagaacatcaaggatgtgtatgagctgaaccgccttgcg
ttctcccatcccgaggatgttccgaccatcgacgtgattccgctgttcgaacagctcgag
gatctgcagaactcggtggacgtgctcgaagacatgatcaagatcccggaggtacaggcc
cgtctgaaggccaccggcggcaagctcgaagtcatgctcggctactccgactcctcgaag
gatgccggcccgacctctgcgacgctggccctgcactccgcacaggagcgtatcgccaag
tgggcggaatcgcacgacatcgacctgaccctgttccacggccgcggcggcgccgtcggt
cgtggtggcggcccggccaaccgtgccgtgctcgcacagccggtcggctccgtaaagtgc
cgtttcaagctcaccgagcaaggcgaggtcatcttcgcacgctacggcaacccggcgctg
gccatccgccacgtggagtccgtcgcagccgcgacgttgctgcagtccgctccgagcgtg
gagaagcgcaacaccgacatgaccgagaagtatgcggacatggcgaacaagctcgacgag
gccgcgcataaccgcttcctcgacctgctcaatacgccggatttcgccccgtggttctcc
accgtcacgccgcttaccgaaatcggcctgctgccaatcggttcccgccctgccaagcgt
ggtctcggcgccaagtccctcgatgatttgcgtaccattccgtggatcttctcttgggcg
caggcacgcatcaatttggccgcatggtatggtctcggcaccgcatgcgagcagttcggc
gaccttaagaccctgcgtcaggcatacgaggaatggccgctgttctcgacgttcatcgac
aacatcgagatgtcgctggccaagaccgacgaacgcatcgccaagatgtatctggctctc
ggcgaccgtgaagacctcaataagaaggtgctcgacgagatggagctcacccgcgaatgg
gtgctcaagatcgtcggcgatgagtggccgttgcagcaccgccacgtgctcggtcaggcc
atccgcatccgctcgccgtatgtggacgcgctatccgttacccaggtgctcgccctcggc
tcgctacgcaagcaagtggacaaggaagaactgacccacggtcagcaggagaattacacc
tacttgattctgtgcactgtttcgggcgttgctgcaggtctgcagaacaccggctga

DBGET integrated database retrieval system