KEGG   Bacteroides dorei HS1_L_1_B_010: EL88_15630Help
Entry
EL88_15630        CDS       T03262                                 

Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
bdo  Bacteroides dorei HS1_L_1_B_010
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bdo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    EL88_15630
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EL88_15630
Enzymes [BR:bdo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     EL88_15630
Bacterial toxins [BR:bdo02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   EL88_15630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3372782..3374422)
Genome map
AA seq 546 aa AA seqDB search
MRNPSLLLLIVVFILAPFKLSAAADTVAVRETRIPVLIERQDNELFHLRIEAAQSQMLNE
VKLDFGKDVNLNEIESVKLYYGGTESVERRGKTYFAPVDYISNNTPGKTLAANTSYSVLK
SEVKAPKREVILKADQKLFPGVNYFWISLQMKPIASILSKVSAKVVEAKIDGQIAPLKIV
RKADTHYMGVGVRHAGDDGAAAYRIPGLVTSNKGTLLGVYDVRYNNSADLQEYVEIGLSR
STDGGQTWEKMRIPMAFGEYDGLPKAQNGVGDPAILVDKKTGTIWIVAAWTHGMGNGRAW
WNSQTGMDRNHTAQLMMVKSDDDGKTWSEPMNITEQVKDPSWYFLLQGPGRGISMEDGTL
VFASQYIGSDRIPNAGVIYSKDHGKTWNISTLARTNTTESQVVEVEPGVLMLNMRDNRGG
SRAVSTTTDLGKTWKEHESSRTALQEPVCMASLISVKAKENVLGKDILLFSNPNDTKNRH
SITIKASLDGGVTWLPENQLLLDAGWGWGYSCLTMIDKETVGILYESSVAHMTFQAIKLK
DIVKTK
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaccctagcttattactgctaattgttgtttttatattagcacccttcaagtta
agtgcggcggcagatacggttgctgtccgcgaaacccggattcctgtgttgattgaaagg
caggataatgagttgtttcatttacgtatagaggctgctcaaagtcagatgctgaatgaa
gtgaagttggacttcggcaaagacgtgaatttaaatgaaattgaatctgtgaaactttat
tatggtggaactgaaagcgtggagaggagaggaaagacttattttgctccggtagattat
atatctaataatactccgggaaaaacattggctgccaatacttcttattccgttttgaag
tcggaagtaaaggccccgaagcgcgaggttatattgaaagctgaccaaaaattgtttccg
ggagtgaattatttttggattagcctgcaaatgaagcctattgcttctatcttgtctaaa
gtgtcggcaaaagtggtggaagctaagattgacggacagattgctcctttgaagatagtt
cgtaaggcggatacccattatatgggggtaggcgtgcgccatgccggtgatgacggggct
gctgcctatcgtattcccgggttggtcacttcaaataaaggaaccttgttgggggtatat
gatgtacgctataataatagtgcggatttacaggagtatgtggaaataggtctgagcaga
agtacggacggagggcagacttgggagaaaatgcgcattccgatggcatttggtgaatat
gatggtctgcctaaagcacagaatggagtaggtgatcctgccattttagttgataaaaag
acaggaactatctggattgttgctgcctggacacatggtatggggaatggtcgtgcgtgg
tggaattcacaaacaggtatggaccgtaatcatacagcgcaattaatgatggtgaaaagt
gatgatgatggtaaaacctggtcggagcctatgaatataacagaacaggtgaaagatccg
tcatggtatttcttgctgcaaggtcccggtagaggtatctctatggaagatggaacattg
gtctttgccagtcagtatattggcagtgatcgtattcctaatgccggtgttatatacagt
aaggatcatggaaagacatggaatatcagcacattggcacgcactaatactactgaatct
caggtagtggaagtggaaccgggagtgctgatgctgaatatgcgtgataatcgtggcggc
agtcgtgccgtttctacaactacagatttaggtaaaacgtggaaagaacatgaatcttca
cgtacagccttacaggaaccggtttgtatggccagtttgattagtgttaaagctaaagag
aatgtattaggtaaagacattcttttgttctctaatccgaatgataccaagaaccgtcat
agcattaccatcaaagcaagtctggatggcggggtgacttggttgcccgagaatcaattg
ttgttggatgccggttggggttggggatatagctgcttaactatgattgacaaggaaaca
gtagggattttatatgaaagcagtgtggcccacatgactttccaagcgataaaattgaaa
gatattgtaaagaccaaataa

DBGET integrated database retrieval system