KEGG   Bacteroides fragilis BOB25: VU15_13725Help
Entry
VU15_13725        CDS       T03897                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bfb  Bacteroides fragilis BOB25
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VU15_13725
Enzymes [BR:bfb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VU15_13725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3385163..3386608
Genome map
AA seq 481 aa AA seqDB search
MENGVMMQYFEWNLPNDGNLWKQLKEDASHLHEIGVTAVWIPPAYKADEQQDEGYATYDL
YDLGEFDQKGTVRTKYGTKEELKEMIDELHKNHISVYLDVVLNHKAGGDFTEKFIVVEVD
PNDRTQVLGKPFEIQGWTGYSFHGRKDKYSDFKWHWYHFSGTGFDDAKKRSGIFQIQGEG
KAWSEGVDNENGNYDFLLCNDIDLDHPEVVTELNRWGKWVSKELNLDGMRLDAIKHMKDK
FIAQFLDAVRSEKGDKFYAVGEYWNGDLNTLDAYIKSVGHKVNLFDVPLHYNLFQASQEG
KNYDLQNILKNTLVEHHCDLAVTFVDNHDSQSGSSLESQIEDWFKPLAYGLILLMKDGYP
CLFYGDYYGVKGENSPHTQIINILLDARRKYAYGDQIEYFDHPSAIGFIRTGDEEHVGSG
LVFLMSNDEAGSKKMDLGEEHKGEIWHEITGNIQQEITLDEKGSGEFSVNTRNIAVWIKK
N
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggtgtaatgatgcagtattttgaatggaatctgccaaatgacggaaattta
tggaaacaattaaaagaagatgcatcacatttacatgagattggtgtgacagcagtatgg
attccccccgcttacaaagccgacgaacaacaagacgaaggttatgcaacctacgatttg
tatgatctcggcgagtttgatcaaaaaggaaccgtaagaacgaaatatggtacgaaagaa
gaactgaaagaaatgatcgatgaattacataaaaatcatatttccgtttatctggatgta
gtactgaatcataaggcaggaggtgatttcactgaaaagttcatagttgtagaagtcgat
cccaatgatagaacccaagtattaggaaaaccgttcgaaatacagggctggaccggatac
agcttccatggacgtaaggataaatattcagacttcaaatggcattggtatcatttttca
ggaaccggttttgacgatgccaaaaagcggagtggcatcttccagatacagggtgaaggc
aaagcgtggagcgaaggggttgacaatgaaaatggcaactacgatttcttattatgcaat
gatatagacctggatcatcctgaagtagtcaccgaattgaatcgttggggaaaatgggtt
tccaaagagctgaacctcgacggaatgcgtctggatgccatcaaacacatgaaagacaag
ttcattgcacaattcctggatgcggtaagaagcgaaaaaggagacaaattctacgctgtt
ggcgaatattggaatggtgatttgaacacactcgatgcatacataaaatccgtgggtcac
aaagtcaacctatttgatgttccattacattataatttattccaagcatcacaagaaggc
aagaattatgatctgcagaatatcctaaaaaacacattagtcgagcaccactgtgatctg
gcagtcacttttgtcgacaatcacgattcgcaatcgggcagttccttggaatcacaaata
gaagactggttcaaaccattggcctatggtctgatattattaatgaaagacggttatcct
tgtttgttctacggagattattatggtgtcaaaggagaaaactcacctcatacccaaatc
attaatattcttctggatgccagaagaaaatatgcttatggcgatcagattgagtatttc
gatcatccttccgccatcggctttattcgtacgggagatgaagaacatgtcggttccggt
ttagtctttttaatgtctaatgatgaagccggcagtaaaaagatggatttgggcgaagaa
cataaaggtgaaatatggcatgaaataaccggaaatattcagcaagaaatcacattagac
gaaaaaggaagtggagaattttctgttaatacccgtaatattgctgtttggataaaaaag
aattaa

DBGET integrated database retrieval system