KEGG   Paraburkholderia fungorum: OI25_663Help
Entry
OI25_663          CDS       T03799                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bfn  Paraburkholderia fungorum
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bfn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OI25_663
  Energy metabolism
   00680 Methane metabolism
    OI25_663
Enzymes [BR:bfn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     OI25_663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:743967..747098
Genome map
AA seq 1043 aa AA seqDB search
MTSSGSARPARRNTASPNAQAADAASASASAATAAQSTPAKRAGKAGKTSQPANVAKTAR
SAKTAAKANKAVKDVKIEKVAQAAKAPKLQAVSQDAAVPAPAPKSSARTREDKDHPLFQD
IRYLGRLLGDVLREQEGDAVFDVVETIRQTAVRFRREDDNAAAQTLDKKLRSLSPEQTVS
VVRAFSYFSHLANIAEDRHRNRRHRIHALAGSTSQPGTMAHTLERLVAAGAAATPVLQQF
FNEALIVPVLTAHPTEVQRKSILDAQHDVARLLAERDQPLTDRERAHNEAMLRARVTSLW
QTRMLRDSRLSVADEIENALSYYRATFLEEIPALYADIEEALTEHGIDARLPPFFQMGSW
IGGDRDGNPNVTAETLENAITRQAAVIFEHYMEQVHKLGAELSVSNLLAGASDELKALAA
ASPDQSPHRTDEPYRRALIGMYTRLAASARVRLGEGSVPVRSAGRGAAPIRAIPYDDSAD
FVRDLHVLIDSLAAHHGAPLAAPRLSPLARAAEVFGFHLASIDLRQSSDIHEAVVAELLK
RAGVENDYASLAEEDKLKVLLAELSQPRPLRLPYTEYSDLVKSELGVLEEARVTREKFGL
RAVRNYIISHTETVSDLVEVMLLQKETGLLQGRLGDANDPARAGLMVIPLFETIPDLRNA
PHIMRDLIALPGMDALIEHQGNEQEVMLGYSDSNKDGGFLTSNWELYRAELALVSLFNQR
GVTLRLFHGRGGTVGRGGGPTYQAILSQPPGTVDGQIRLTEQGEVIASKFGNPEIGRRNL
ETVVAATLEASLLPHGIAPAQLPAFEETMQQLSDAAMASYRALVYETPGFKEYFFESTPI
SEIAELNIGSRPASRKLQDPKQRKIEDLRAIPWGFSWGQCRLLLTGWYGFGSAVAAHLDG
APSDAERARRLALLKKMHKTWPFFSNLLSNMDMVLAKTDLAVASRYAQLVTDKKLRKHVF
ERIVAEWERTSKVLSEITGKSERLAENPLLARSIKNRFPYLDPLNHLQVELLKRHRAGDT
NARVRRGIHLTINGIAAGLRNTG
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcttccggatcggcgcgccctgcccgccgcaacactgcatcgcccaacgctcaa
gcggccgacgccgcttctgcttctgcctccgccgccacggctgcccagtccaccccggcc
aaacgcgccggcaaagctggcaagacaagccagcctgccaacgtcgccaaaaccgccagg
tccgccaaaaccgccgcgaaggccaataaagcggtgaaggacgtcaagatagaaaaggta
gcgcaagccgcaaaagcgcccaagctgcaagccgtttcgcaggacgcggccgtgcccgcg
cccgcgccgaaaagcagcgcccgcacgcgcgaagacaaggatcatccgctgtttcaggac
atccgctatctgggacgcctgctcggcgacgtgctgcgcgaacaggaaggcgacgcggtg
ttcgacgtcgtggaaacgatccgtcagaccgccgtgcgttttcgccgtgaagacgacaac
gccgccgcccagacgctcgacaagaaactgcgctcgctgagcccggagcaaacggtcagc
gtggtgcgcgcgttcagctacttttcgcaccttgcgaatatcgccgaagaccgccaccgc
aatcgccgtcaccggattcacgcgctggccggctcgacttcgcagccgggcaccatggcg
cacacgcttgagcggctggttgccgcgggtgccgcggcaacgccggttctgcagcagttc
ttcaacgaagcgttgatcgtgccggtcctgaccgcgcaccccaccgaagtgcagcgcaag
agcattctcgacgcacagcacgacgtcgcgcggctcttggccgaacgtgatcagccgttg
accgaccgcgagcgcgcgcataacgaagcgatgctgcgcgcccgcgtcacgtcgctgtgg
caaacgcgcatgctgcgtgattcgcgcctctccgtggccgacgaaatcgagaacgcgctg
tcgtactatcgcgccaccttcctcgaagaaatcccggcgctctacgccgatatcgaagaa
gcgctcaccgaacacggtatcgacgcccgcctgccgccgttcttccagatgggcagctgg
atcggcggcgaccgcgacggcaacccgaacgtcacggccgaaacgctggagaacgcgatt
acccgccaggccgcggtgatcttcgagcactacatggagcaggtgcacaagctcggcgcc
gagttgtcggtgtcgaacctgctggccggcgcgagcgatgagctcaaagcactcgccgcc
gcttcgcccgaccagtcgccgcaccgcaccgacgaaccgtatcgccgcgcgctgatcggc
atgtacacgcggctcgcggctagcgcccgcgtgcgcctgggcgaaggcagcgtgccggtg
cgcagcgccgggcgcggcgcggcgccgatacgtgcaataccgtatgacgattccgccgat
ttcgtgcgcgacctgcacgtgctgatcgattcgctggccgcgcaccatggcgcgccgctc
gcggcaccgcgcctgtcgccgctcgcgcgcgccgccgaagtgttcggcttccatctggca
agcatcgacttgcggcaaagctcggacatccatgaagccgtggtcgccgagttgctgaag
cgcgcgggcgtcgaaaacgactatgcgtcgctcgccgaagaagacaagctcaaggtgctg
ctcgccgagctttcgcagccgcgcccgctgcgtctgccctacaccgagtactccgatctc
gtgaagagcgaactcggtgtgctcgaggaggcgcgcgtcacgcgtgaaaagttcggcctg
cgcgcggtgcgcaactacatcatttcgcatacggagaccgtcagcgatctggtcgaagtc
atgttgctgcaaaaggaaaccggcctgctgcaaggacgtttgggcgacgcgaacgatccg
gcgagagcaggcttgatggtgattccgctgttcgagacgatccccgacttgcgcaacgcg
ccgcacatcatgcgcgatctgatcgcgctgccgggcatggatgccttgatcgaacaccag
ggcaacgaacaggaagtgatgctcggctattcggacagcaacaaggacggcggcttcctg
acgtcgaactgggagctgtatcgcgccgagctggcgctggtgtcgctgttcaatcaacgc
ggcgtgacgctgcgcctgttccacggccggggcggcacggttggccgtggcggtggcccg
acgtatcaggcgattctgtcgcagccgccgggcaccgtcgacggccagatccgtttgacc
gaacagggcgaagtgatcgccagcaagttcggcaatccggaaatcggccggcgcaatctg
gaaacggtcgtggccgcgacgctcgaagcttcgttgttgccgcacgggattgcgcccgca
caactgccggccttcgaagagaccatgcagcagttgtccgacgcggcgatggcgtcgtat
cgcgcgctggtctacgaaacgccgggcttcaaggagtatttcttcgagtcgacgccgatc
tcggagatcgccgagttgaacatcggcagccgtccggcttcgcgcaaactgcaggacccg
aagcaacgcaagatcgaggatctgcgcgcgattccgtggggcttctcatggggccaatgc
cgtttgttgctaaccggctggtacggtttcggcagcgcggtggccgcgcatctggacggc
gcaccgagcgacgccgagcgcgcccgccgccttgcgctgctcaagaagatgcacaagacc
tggccgttcttctcgaacctgctctccaatatggacatggtgctggcaaagaccgacctc
gcggtggcctcgcgctacgcgcagctcgtgacggacaagaagctgcgcaagcacgtgttc
gagcggatcgtcgcggaatgggagcggacctcgaaggtgctgtcggagatcaccggcaag
agcgaacggctcgcggagaatccgctgctcgcgcgttcgatcaagaaccgcttcccgtat
ctcgacccgctcaatcacttgcaggtcgagttgctcaaacgtcaccgtgcgggggacacc
aacgcgcgcgtgcggcgcgggattcacctgacaatcaacgggatcgcggcgggcttgcgc
aataccggctaa

DBGET integrated database retrieval system