KEGG   Bacteroides fragilis YCH46: BF4242Help
Entry
BF4242            CDS       T00202                                 

Definition
(RefSeq) exo-alpha sialidase precursor
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00511  Other glycan degradation
bfr00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bfr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BF4242
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BF4242
Enzymes [BR:bfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BF4242
Bacterial toxins [BR:bfr02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BF4242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_assoc_N BNR_2 BNR_3 BNR Sortilin-Vps10 CHB_HEX_C End_beta_propel
Motif
Other DBs
NCBI-GeneID: 3085323
NCBI-ProteinID: YP_101518
UniProt: Q64NE9
LinkDB All DBs
Position
4836372..4838006
Genome map
AA seq 544 aa AA seqDB search
MKFYLLFIFISLNLCSFSARATDTIFVYETQVPILIERQDNMLFLMRLTTARSDTKLNEV
VLRLGQNVNLSNIQSIKLYYGGTEARQNYGKELYLPVTYISRDVSGKTLAANPSYSINKS
QVNNPGRKVILNANQKLFPGINYFWISLQMKPGASLLDKVSAKIVTVKVDNKEALIYTVS
PENITHRVGVGVRHAGDDGSAAFRIPGLATTNKGTLLGVYDVRYNSSVDLQEHMDVGLSR
SVDGGKTWEKMRLPLAFGETGGLPAAQNGVGDPSILVDTKTNTTWVVAAWTHGMGNQRAW
WSSYPGMDMNHTAQLVLSKSTDDGKTWSEPINITDQVKEPSWYFLLQGPGRGITMQDGTL
VFPIQFIDSTRVPNAGIMYSKDRGETWKIHNYARTNTTEAQVAEVEPGVLMLNMRDNRGG
SRAVATTKDLGKTWTEHPSSRKALQEPVCMASLISVKAADNTLNKDILLFSNPNTVKGRH
HITIKASLDGGITWLPEHQVMLDEGDGWGYSCLTMIDKETVGILYESSVAHMTFQAIRLR
DIIQ
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttatttgctttttatttttatctccttaaatctgtgttccttttctgcacga
gctacagatactatttttgtttatgaaacacaagttccaattttgatagaacgccaagat
aacatgttatttttaatgcgtttgactactgctagaagtgatacaaaattaaatgaagtg
gttttacgattgggtcaaaatgtgaacttgtcaaacatccaatctatcaagttgtattat
ggaggtacggaagcacgtcagaactatggtaaggagctttatcttcctgttacctacatt
tctcgtgatgtgtcagggaagacattggctgcgaatccttcttattcgattaataaatca
caggtaaataatcccgggcggaaagtgatactgaatgctaatcagaaactttttcccgga
atcaattatttttggatcagtctgcaaatgaaaccgggcgcctctttgctggataaagtg
tcagctaagattgttactgttaaggttgataataaagaagcacttatatatacggtttca
ccggagaatataactcatagggtaggagtaggggtacgccatgccggtgatgatggttcg
gctgctttccgtattccgggattggcaactactaataaaggaacattgctgggagtttat
gatgtacgttataatagcagtgttgatttgcaggaacacatggacgtcggtttgagccgt
agtgtagacggtggtaaaacatgggagaagatgcgtttacctttagcttttggtgaaact
ggcggtttgcctgctgctcagaacggcgttggcgacccttcgatcttagtggataccaag
accaacacaacatgggtggtggcggcttggacacatggaatgggtaatcagcgtgcttgg
tggagttcttatccgggaatggatatgaatcatacggcccagttggtattgtcaaagagt
acggacgatggtaaaacgtggtcggagcctattaatataacagatcaggtgaaagagcca
tcctggtatttccttttgcaaggaccgggacgaggtatcaccatgcaagacggcacattg
gtattcccgattcagtttatcgattctacccgtgttccgaatgcgggaattatgtatagc
aaagaccgtggcgaaacatggaaaatccataactatgcgcgcaccaatacaacagaagct
caagtagcggaagtggagcctggcgtactgatgttaaatatgagagataaccgtggaggt
agtcgtgctgtcgctactaccaaggatctcggtaagacttggacagaacatccttcttcc
cgtaaagctttacaggaaccggtgtgtatggcaagtttaatcagcgtgaaagcggcagac
aacacattaaataaggatattcttttattctccaatccgaatacggtaaaaggtcgtcat
catatcacgatcaaggccagtctggatggaggtatcacctggctacccgaacatcaagtg
atgctggatgaaggtgacggttggggatattcttgtttgacaatgattgataaagagaca
gtcggcatattatatgaaagcagtgtcgctcatatgacttttcaggcaatccgactgaga
gatataatacaatag

DBGET integrated database retrieval system